4KY9


Conserved Protein Domain Family
Band_3_cyto

?
pfam07565: Band_3_cyto 
Click on image for an interactive view with Cn3D
Band 3 cytoplasmic domain
This family contains the cytoplasmic domain of the Band 3 anion exchange proteins that exchange Cl-/HCO3-. Band 3 constitutes the most abundant polypeptide in the red blood cell membrane, comprising 25% of the total membrane protein. The cytoplasmic domain of band 3 functions primarily as an anchoring site for other membrane-associated proteins. Included among the protein ligands of cdb3 are ankyrin, protein 4.2, protein 4.1, glyceraldehyde-3-phosphate dehydrogenase (GAPDH), phosphofructokinase, aldolase, hemoglobin, hemichromes, and the protein tyrosine kinase (p72syk).
Statistics
?
PSSM-Id: 311498
View PSSM: pfam07565
Aligned: 16 rows
Threshold Bit Score: 346.593
Threshold Setting Gi: 114786
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4KY9_P         36 ENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAG 115
gi 121995318   99 DVEEGGNRWSKPHVATLSLHSLFELRRLLVNGTVMLDMEAPNLEVMADLVCDQMVSAGTLPPGVKDKVKDALLRRHRHQH 178
gi 122107038  264 DVEEGADRWGRPHVASLSFHSLLNLRRCLETGVVLMDLEEKDLPSVAYRIVEQMVIDELIHEDDKPTIMRALLLRHRHVN 343
gi 6225077    351 DVEEETERWGKPHVASLSFRSLLELRRTIAHGAALLDLEQTTLPGIAHLVVETMIVSDQIRPEDRASVLRTLLLKHCHPN 430
gi 85687559   352 DVEEETERWGKPHVASLSFRSLLELRRTLAHGAVLLDLDQQTLPGVAHQVVEQMVISDQIKAEDRANVLRALLLKHSHPS 431
gi 114788     100 ENLREDGVWGRPHLSYLTFWSLLELQKVFSKGTFLLGLAETSLAGVANHLLDCFIYEDQIRPQDREELLRALLLKRSHAE 179
gi 75051775    21 ENLGKDGIWGRPHLPYLNFWSLLELQKAFAKGTVLLDLPGKSLAEVANQLLDRFTFEGQIQPDDQDNLLRVLLLKHSHAS 100
gi 664723506  102 enlgEDGAWGHPHLSYLDFWSLLDLQRAFAKGSVLLDLSETSLAGVAENLLDRFIYDGLIRPQYREDLLRVLLLKHSHAR 181
gi 158286522   85 NLEEEADRWGRPHVAALSFHSLLNLRHCLETGVVLMSLEANDLSIVAHRVVEQMVARELIHEDDKPVIARALLLRHRHVN 164
gi 969518135  303 DVEEGSDRWGKPHVASLSFHSLLNLRRCLETGVVLLDLNEKDLPAVAYRVVEQMVIEDLIDINDKPSVMRSLLLRHRHVN 382
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4KY9_P        116 ElEALGGVKPAVLTRSG-----------DPSQPLLPQHSSLETQLFCEQGDGG--------------------------- 157
gi 121995318  179 E-YAKKTRLPIIRSLADmrnhssskkkkSNSKNLRPTQNLPVITEDMVKSPSSqsmarps-------------------- 237
gi 122107038  344 EhSHGGFHFGPKRKYSSyssl----qsvDDKKPRIVPSSEINGH--GHGETKInmheety-------------------- 397
gi 6225077    431 D-DKDCGSFPRNPSSSSvnsvl--gnhhATPSHGPDGAVPTMADDLGEPAPLWphdpdaker------------------ 489
gi 85687559   432 DeKDFS--FPRNISAGSlgsll-ghhhgQGAESDPHVTEPLMGGVPETRLEvererelpp-------------------- 488
gi 114788     180 DlGNLEGVKPAVLTRSG-----------GASEPLLPHQPSLETQLYCGQAEGG--------------------------- 221
gi 75051775   101 DmEALGGVKPVVVTHSG-----------DPSEPLLPQHPSLETELFCEQGEGS--------------------------- 142
gi 664723506  182 DlKELDGVKPTVLTPSG-----------GTLQPLLPEHPSLETQLFCAQGEGD--------------------------- 223
gi 158286522  165 EnTHGGIFYGSRRRLSSftsir--svknDSRKPRIIPVVEINGH-GGQSEMRLnindesy-------------------- 221
gi 969518135  383 E--HQGVLPFTKRKYNSytslq--flwmGADAQQQSLQQQQTRNLAKARRSICvtssappaaaaaattlnvgspagiass 458
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4KY9_P        158 --------------------------------------------------------TEGHSPSGILEKIPPDSEATLVLV 181
gi 121995318  238 -------------------------------------------------sgtelndQQHKGNTHFMRKIPPGAEASNILV 268
gi 122107038  398 -------------------------------------------------tssqediKMRTQKESILKRIPEGAEATTVLV 428
gi 6225077    490 ------------------------------------------------plhmpggdGHRGKSLKLLEKIPEDAEATVVLV 521
gi 85687559   489 -----------------------------------------------pappagitrSKSKHELKLLEKIPENAEATVVLV 521
gi 114788     222 --------------------------------------------------------SEGPSTSGTL-KIPPDSETTLVLV 244
gi 75051775   143 --------------------------------------------------------TRGHAPE-ILGKSPQDWEATLVLV 165
gi 664723506  224 --------------------------------------------------------TEESSPSGILEKISPDSEAALVLV 247
gi 158286522  222 -----------------------------------------------------tssqediKMCTILKRIPEGAEATTVLV 248
gi 969518135  459 idhrrhstmsylgnlsggtddkkikimpaadiggskrsnelkidmkddmysssqedLKKLQNDTILRRIPAGAEATTVLV 538
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4KY9_P        182 GRADFLEQPVLGFVRLQEAAE----LEAV-ELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGE 256
gi 121995318  269 GEVDFLERTLSCFIRLSQAAL----MGDLtEVPVPTRFIFILLGPPGSQSNFHEIGRAMATLMSDEIFHEVAYRARKREH 344
gi 122107038  429 GSVDFLEQPTIAFVRLAEGIP----MPSItEVPIPVRFLFILLGPKTAELDYHEVGRSIATLMSNEHFHDIAYRADDRKD 504
gi 6225077    522 GCVPFLEQPAAAFVRLSEAVL----LESVlEVPVPVRFLFVMLGPSHISTDYHELGRSIATLMSDKLFHEAAYQADDRQD 597
gi 85687559   522 GCVEFLSRPTMAFVRLREAVE----LDAVlEVPVPVRFLFLLLGPSSANMDYHEIGRSISTLMSDKQFHEAAYLADERED 597
gi 114788     245 GRANFLEKPVLGFVRLKEAVP----LEDLv-LPEPVGFLLVLLGPEAPHVDYTQLGRAAATLMTERVFRITASMAHNREE 319
gi 75051775   166 GCARFLKRPVLGFVRLKEPMEpepkPEGSeEPAVPVRFLIVLLGPEGPNINYTQLGRAAATLMSERVFWNDAYLAQSKET 245
gi 664723506  248 GRISFLEKPVLGFVRLREAVE----LEATvEPSVPVRFLLVLLGPEAPHTDYTQLGRAAATLMSERVFLNEANTAQSKEE 323
gi 158286522  249 GAVDFLEQPTIAFVRLAEGIP----MPSItEVPIPVRFLFLLLGPQKTDLDYHEVGRSIATLMSNEHFHDIAYTADDREE 324
gi 969518135  539 GAVEFLDQPTIAFVRLSEGVM----MPTLtEVPVPVRFMFVLLGPRNFDLDYHEVGRSISTLMANEHFHAIAYKADDRKD 614
                         330       340
                  ....*....|....*....|...
4KY9_P        257 LLHSLEGFLDCSLVLPPTDAPSE 279
gi 121995318  345 LLAGVDEFLDAVTVLPPGEWDPT 367
gi 122107038  505 LLSAINEFLDDSIVLPPGKWERQ 527
gi 6225077    598 LLGAISEFLDGSIVIPPSEVEGR 620
gi 85687559   598 LLTAINAFLDCSVVLPPSEVQGE 620
gi 114788     320 LLRSLESFLDCSLVLPPTDAPSE 342
gi 75051775   246 LVQSLEGFLDCSLVLPPLDAPSE 268
gi 664723506  324 LVRSLEGFLDCSLVLPPLDAPSk 346
gi 158286522  325 LLSAIDDFLEDSIVLPPSKWERQ 347
gi 969518135  615 LLSAINEFLDDSIVLPPGNWDRH 637
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap