Conserved Protein Domain Family
Hira

?
pfam07569: Hira 
TUP1-like enhancer of split
The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin. These proteins also contain pfam00400.
Statistics
?
PSSM-Id: 336745
View PSSM: pfam07569
Aligned: 106 rows
Threshold Bit Score: 136.986
Threshold Setting Gi: 674580147
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3023951    667 LLPPIMIESKASFLHC--NN--AYLLCISSSGMVYAWN--VV--NKTALFTANSLAPILSrvsnnvt-----iennstDI 733
gi 255072801  523 AMPPLVTPGRAAFVSA--SG--GRLVAVTGDCSLIVWDlgVP--GQETQVMRESVAPLLSgpr-------------apPA 583
gi 159470767  692 LFPPIRLGWPAAFLTV--APgsSLLLALLTDGSLKLWD--FG--AGECLLES-SVAPLLLppgagvpglaaavaaaqpPV 764
gi 302793957  690 ALPSMVVGSAAAFMDCt-RG--WELLLLTRGGTMHVWD--LR--QSQCLLNESLLPLTLSssats--------sakesGV 754
gi 145349146  605 YMPSLLLPDRAAFLVSgkDD--SSLLIVTRDYTLLVWN--VAvgKETCTLKAD-CSALVRsss--------------rsG 665
gi 731394649  540 ALPTMMMGSAAVFIDC--DEc-WKLLLVTRKGSLFVWD--LF--NRNCLL-HDTLACLITsdlns--------sakdaGT 603
gi 571494100  537 AMPTMMMGSATTFVDC--DEc-WTLLLVTRKGSLYMWD--LF--NQTCLL-QDSLTSLVAsspns--------ygkdaGT 600
gi 695041342  706 AMPAMMMGSAAVFVDC--NEs-WNLLLVTRRGLLYVWD--LF--KRTCIL-HESLASLVTsreds--------stkdaGT 769
gi 721682558  534 AMPAMMMGSAAVFIDC--DNc-WKLLLVTRRGLMYIWD--LY--NRTCIL-QDSLASLVAspdea--------sakdaGT 597
gi 586749991  709 AMPMMMLGSAATFVDC--DEg-WKLLLVTRVGSVYLWD--LF--NRTCVL-RDSLASLITstpds--------ssknpGT 772
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3023951    734 PHVVIASISKEGVPSVTLSTGETYVYSSTMLCWQRITEPWWAIGSREWDSSGLLQSNTQTESQPLKIYEHRTNNVLMDS- 812
gi 255072801  584 PPMVGVRLAKCGSPIAQFADGHAYVFHPKLKSWARVADQSFP-RSEFTTRLRLPAAAGGLGQGELHALQVAAARAAVGM- 661
gi 159470767  765 LKVTAVRITASGAPLVVLSNAHAYVHHGGLRTWVRVADDAFPA-SAFTTNLTSAAT------GELSKLQAAVAQRRHPA- 836
gi 302793957  755 MRIISARFSEAGAPLVVLANGHAFLFHTKMRSWLRIADDFFP-SSSFVSTWPPS------GDGELAGLQ---------K- 817
gi 145349146  666 VALATVRLSKSGAPIFTFTNGYAYVYHSDLQTWARVADQSF-MRSEFTSRLRQPGSSGF---GEMQALQIAAARAAAHV- 740
gi 731394649  604 IKVISAKLAKSGSPLVILATRHAFLFDMSLMCWLRVVDDCFPG-SNFASSWNLGLIQSg----ELATLQVDVRKFLARKp 678
gi 571494100  601 IKVISVKLSKSGSPLVVLATRHAFLFDMNVKCWLRVADDCFPA-SNFSSSWSLGSIQSg----ELAALQVDLRKYLARKp 675
gi 695041342  770 IRVISARFSRAGSPLVVLATRHAFLFDMSLMCWLRIADDCFPA-SNFASSFNLSSIQSg----ELGKLQVDVGKFMARKp 844
gi 721682558  598 VKVISAKFSKCGSPLVTLVNRHSFLYDMNMKCWLRIADDCFPA-SNFSSSLNLGSTQGg----ELGKLQIDLGKFMARKp 672
gi 586749991  773 IKVISARFTRSGSPLVVLATRHAFLYDLNLKCWLRIADDTFPA-SNFTSSWNLGSSQSg----ELAALQVDVGKFLARKp 847
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 3023951    813 --GRG-KLLQKMVADAITEEGYDDFETIVTINHLENKIASARLLKLDDEFLVTSEVYVRLLMHHGLWQK 878
gi 255072801  662 --GPS-ALLSGGAPA----------PRRETGRHLECLLAAADMLGSQAEYRAWLRAYSRHLAAEGAEGh 717
gi 159470767  837 --DVM-TTSALHAARPAAAARSEQ-------AVLEHNLASAAALQSPAEWRLWLITYVRRLAADEDESR 895
gi 302793957  818 --GAA-TL----GKTNFSWNRTLINEKYQTRAHLEDQLAAALALKSAEEYKRHLISYTRFLTREADEVR 879
gi 145349146  741 --GPA-ALLQTSGLTA----------RRETGRHLEILVAGAAMLQSADEFKSWLAAYVRHLATEcgddp 796
gi 731394649  679 gwNRV-TD-----------------DGVQTRAHLESQLASSLALKSANEYRQCLLAYIRFLAREADESR 729
gi 571494100  676 gwTRV-TD-----------------DGVQTRAHLETQLASSLALGSPNEYRQCLLSYVRFLAREADESR 726
gi 695041342  845 swTRV-TD-----------------DGTQTRAHLETQLASSLALKSPNEYRQCLLSYIRFLAREADESR 895
gi 721682558  673 iwSRV-TD-----------------DGVQTRAHLETQLAASLALKSPQEYRQCLLAYIRFLAREADESR 723
gi 586749991  848 swSRVlTD-----------------NGVQTRAHLESQLASSLALKSPTEYRQCLLSYIRFLAREADESR 899
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap