Conserved Protein Domain Family
Hira

?
pfam07569: Hira 
TUP1-like enhancer of split
The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin. These proteins also contain pfam00400.
Statistics
?
PSSM-Id: 311499
View PSSM: pfam07569
Aligned: 105 rows
Threshold Bit Score: 137.375
Threshold Setting Gi: 674580147
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3023951    667 LLPPIMIESKASFLHC--NN--AY-LLCISSSGMVYAWN--VV--NKTALFTANSLAPILSrvsnnvt-----iennstD 732
gi 168019698  722 AQPSLMLGSAAAFMDC--DE--NWkLMVVTRNGSLYLWD--LQ--ESRRLLH-ESLGPLLNstsans-------mlasnG 785
gi 255072801  523 AMPPLVTPGRAAFVSA--SG--GR-LVAVTGDCSLIVWDlgVP--GQETQVMRESVAPLLSgpr-------------apP 582
gi 159470767  692 LFPPIRLGWPAAFLTV--APgsSL-LLALLTDGSLKLWD--FG--AGECLLES-SVAPLLLppgagvpglaaavaaaqpP 763
gi 302793957  690 ALPSMVVGSAAAFMDCt-RG--WE-LLLLTRGGTMHVWD--LR--QSQCLLNESLLPLTLSssats--------sakesG 753
gi 145349146  605 YMPSLLLPDRAAFLVSgkDD--SS-LLIVTRDYTLLVWN--VAvgKETCTLKAD-CSALVRsss--------------rs 664
gi 731394649  540 ALPTMMMGSAAVFIDC--DEc-WK-LLLVTRKGSLFVWD--LF--NRNCLL-HDTLACLITsdlns--------sakdaG 602
gi 571494100  537 AMPTMMMGSATTFVDC--DEc-WT-LLLVTRKGSLYMWD--LF--NQTCLL-QDSLTSLVAsspns--------ygkdaG 599
gi 695041342  706 AMPAMMMGSAAVFVDC--NEs-WN-LLLVTRRGLLYVWD--LF--KRTCIL-HESLASLVTsreds--------stkdaG 768
gi 721682558  534 AMPAMMMGSAAVFIDC--DNc-WK-LLLVTRRGLMYIWD--LY--NRTCIL-QDSLASLVAspdea--------sakdaG 596
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3023951    733 IPHVVIASISKEGVPSVTLSTGETYVYSSTMLCWQRITEPWWAIGSREWDSSGLLQSNTQTESQPLKIYEHRTNNVLMDS 812
gi 168019698  786 TMKLVSARLSKAGAPLVVLANRHAFIFNSSMCCWLRVADDTFPA-SNFVSAWPDAD------DGELANLQAGVA---VAA 855
gi 255072801  583 APPMVGVRLAKCGSPIAQFADGHAYVFHPKLKSWARVADQSFP-RSEFTTRLRLPAAAGGLGQGELHALQVAAARAAVGM 661
gi 159470767  764 VLKVTAVRITASGAPLVVLSNAHAYVHHGGLRTWVRVADDAFPA-SAFTTNLTSAAT------GELSKLQAAVAQRRHPA 836
gi 302793957  754 VMRIISARFSEAGAPLVVLANGHAFLFHTKMRSWLRIADDFFP-SSSFVSTWPPS------GDGELAGLQ---------K 817
gi 145349146  665 GVALATVRLSKSGAPIFTFTNGYAYVYHSDLQTWARVADQSF-MRSEFTSRLRQPGSSGF---GEMQALQIAAARAAAHV 740
gi 731394649  603 TIKVISAKLAKSGSPLVILATRHAFLFDMSLMCWLRVVDDCFPG-SNFASSWNLGLIQSg----ELATLQVDVRKFLARK 677
gi 571494100  600 TIKVISVKLSKSGSPLVVLATRHAFLFDMNVKCWLRVADDCFPA-SNFSSSWSLGSIQSg----ELAALQVDLRKYLARK 674
gi 695041342  769 TIRVISARFSRAGSPLVVLATRHAFLFDMSLMCWLRIADDCFPA-SNFASSFNLSSIQSg----ELGKLQVDVGKFMARK 843
gi 721682558  597 TVKVISAKFSKCGSPLVTLVNRHSFLYDMNMKCWLRIADDCFPA-SNFSSSLNLGSTQGg----ELGKLQIDLGKFMARK 671
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 3023951    813 ---GRGKLLQKMVADAITEEGYDDFETIVTINHLENKIASARLLKLDDEFLVTSEVYVRLLMHHGLWQK 878
gi 168019698  856 ---GPSFLWNRMSL---------SEEKWQTRVHLEVQMSSALALKSASEYRRCLVAYARCLSKESDEAR 912
gi 255072801  662 ---GPSALLSGGAPA----------PRRETGRHLECLLAAADMLGSQAEYRAWLRAYSRHLAAEGAEGh 717
gi 159470767  837 ---DVMTTSALHAARPAAAARSEQ-------AVLEHNLASAAALQSPAEWRLWLITYVRRLAADEDESR 895
gi 302793957  818 ---GAATL----GKTNFSWNRTLINEKYQTRAHLEDQLAAALALKSAEEYKRHLISYTRFLTREADEVR 879
gi 145349146  741 ---GPAALLQTSGLTA----------RRETGRHLEILVAGAAMLQSADEFKSWLAAYVRHLATEcgddp 796
gi 731394649  678 pgwNRVTD-----------------DGVQTRAHLESQLASSLALKSANEYRQCLLAYIRFLAREADESR 729
gi 571494100  675 pgwTRVTD-----------------DGVQTRAHLETQLASSLALGSPNEYRQCLLSYVRFLAREADESR 726
gi 695041342  844 pswTRVTD-----------------DGTQTRAHLETQLASSLALKSPNEYRQCLLSYIRFLAREADESR 895
gi 721682558  672 piwSRVTD-----------------DGVQTRAHLETQLAASLALKSPQEYRQCLLAYIRFLAREADESR 723
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap