5FUR


Conserved Protein Domain Family
TAF6_C

?
pfam07571: TAF6_C 
Click on image for an interactive view with Cn3D
TAF6 C-terminal HEAT repeat domain
TAF6_C is the C-terminal domain of the TAF6 subunit of the general transcription factor TFIID. The crystal structure reveals the presence of five conserved HEAT repeats. This region is necessary for the complexing together of the subunits TAF5, TAF6 and TAF9.
Statistics
?
PSSM-Id: 311500
View PSSM: pfam07571
Aligned: 130 rows
Threshold Bit Score: 57.4899
Threshold Setting Gi: 74685345
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5FUR_J       309 MTCIVSRQLclrpd-------------vdnhWALRDFAARLVAQICKHFSTTTNNIQSRITKTFTKSW------VDE--K 367
gi 123492842 251 msgLIGTDVgsne--------------tdddSNVRRCASQLLNVLHSKCKNAYPAMTKAIYNSLISVL------FNE--T 308
gi 123975778 265 giCLATKEVitkc--------------aredCYIRDIGANIVSLITSRCLNSFPNADIECFNYFNDII------FSE--N 322
gi 123489292 274 qTVVVTNNLin-------------------dECIRQTAGDIIIALIKRASSEYPGIRTEIFNQLVGVS------FNP--E 326
gi 685953404 289 LTTLLTSSYpapp--------------nqhaLWLRQKSASLISRLLHEYGSSYPTLSGRVAKTLLSALkgdqhsVGEiaS 354
gi 588263401 288 LTTLLTSSYpapp--------------dqkaLWLRQKSASLIARLLNDYSNSYPTLSGRVAKTLFKALsgddqvLGEsaS 353
gi 667635707 254 LTCIIGKRIk--------------------nMDIRKLAAETIKYVYDKYSITYDTLGPRIIKTLSKVW------LDK--D 305
gi 667638457 252 LSCVVGKSIs---------------------EEARRLATDLIKYIFDVFSPKYKSLPSRIVSFLLKGW------LDD--S 302
gi 523780605 255 LTCVVGKSVt--------------------dLSLRKYAGDNIKYIYDNFSKSYVTLAPRIINTLKKAW------LDK--E 306
gi 906374065 257 LTCVVGKSIgimhkhpseevlvndsdedtpgLSARRRASITIKYIYDTYSLSYTTLAPRVLNTLLKTW------ADS--T 328
                         90       100       110
                 ....*....|....*....|....*....|.
5FUR_J       368 TPWTTRYGSIAGLAELG-HDVIKTLILPRLQ 397
gi 123492842 309 TSIAAHIGAVYGLEVLG-IESCERVI-PHLa 337
gi 123975778 323 NSIHVLYGALSGIFSLG-NDYIER-ILPHLP 351
gi 123489292 327 TNYPALYGALYTLLNLD-DDAFRTVI-PHAK 355
gi 685953404 355 RDVGTRMGSLLGLMAVGkHTAIRALIhdsgi 385
gi 588263401 354 TDIGTRFGSVLGLKAIGkNTAVRALIhekgl 384
gi 667635707 306 KSEDAHYAALFTLSILS-TNVISSVIQKEKD 335
gi 667638457 303 KPESVQYGALFCLSILS-DNVIKECVVPNIE 332
gi 523780605 307 KSEESQYGAIYCLTSMP-KTSVEKVIRDNYE 336
gi 906374065 329 KSPESHYGAIYCLCNLG-EKVINGVVIQFKK 358
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap