Conserved Protein Domain Family
PSD1

?
pfam07587: PSD1 
Protein of unknown function (DUF1553)
A family of proteins found in Rhodopirellula baltica.
Statistics
?
PSSM-Id: 311514
View PSSM: pfam07587
Aligned: 204 rows
Threshold Bit Score: 136.851
Threshold Setting Gi: 501355623
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81659555   887 NRLDLARWLTDSQ-HPLTSRVAVNRIWSLFFGTGLVATSADFgSQGEYPSHPELLDYLATHFVEIGWDQQQLIREIVSSA 965
gi 81660772   374 PREQFAAWVTSPE-NPRFSQTVVNRLWKRLMGVGFVDPVDDF-RDENPCVNEAAMDYLCKELVRRGFDLKELTRIVLYSQ 451
gi 122939685  252 PREVFADWLITPK-NAWFTRNIANRVWSWLLGRGIIQEADDI-RDDNPPVNAELLAYLEQELSGSKYDLKHLYRLILNSQ 329
gi 505059070  588 RRVVLANWLTSQE-NPFFARELANRTWYHLLGRGIVDPVDDV-RDSNPPASEELLEALAQDLIANRYDVKQLIRTIVNSR 665
gi 503393707  338 PRVVMARWMTSRE-NPRFTKTIVNRLWKRAFGVGLIEPVDDM-RDDTVASNPELMDFLISEMHRLNFDMKEFMRIVYNTK 415
gi 503394558  789 SRTTLAELVTSPR-NERFAQVIANRVWKRLIGRGIVEPVEDW-ETGEP-SHPELMKWLGRKFVEQGYDLKELTRTIVSSD 865
gi 502875372  838 RREQLAVLVTSPA-NRRFADVIVNRLWQRYLGKGIVEPIDDW-ETPDP-THPQVLSILEQELIASGYELKQIARVILNTE 914
gi 502673525  787 TREQLAVRITSPH-NTRFAKVLANRFWHRYIGRGIIEPVDDW-EQGDN-VHPELLEFLARKLIESGYDAKSLARLILNSD 863
gi 918008953  262 PRKEFVKLALDPAnRTFMARSIINRTWARLMGRGLVHPVDQM-HSGNPSNHPVLLDWLERDFIDHGFDLSRLIRGIVLSD 340
gi 502677476  575 TREPLMHWLRSKE-NPYFAKAFVNRVWANYFNVGIVQPPDDL-SLANPPSNKPLLDYLAQGFIEHNFDMKWLHREILSSR 652
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81659555   966 TYRQQSSatPEQIEl-DPKNRLLARGPRFRLPAEFIRDQALAVSdllvphvggpslqpyqppalwkev---------shf 1035
gi 81660772   452 TYQRKAV--DYDIT--DGDLYYFPGPTVRRMTAEQVWDSILTLAvdnpwpfqrptakemkpvmdldfskvdfeevqrrsa 527
gi 122939685  330 TYQLSSIarDDHPKtsAEAAANFAQYPIRRLDAEVLADAICDITgttesytsaip------------------------- 384
gi 505059070  666 VYQLASL--PDEET--HGGARYFVSAVVKMVPAEPLLDAISSATgspelfddpdqrnrdagqk----------------- 724
gi 503393707  416 TYQRQSS--PEEFD--PAEPYHFPGPVLRRMSPEQVWDSFITLAledpnkfqrepaelqasllkvdlasvda-mevyerd 490
gi 503394558  866 LYQQKVVteF-------EQEQFFAGPTRRRMTAEQLVDTVYMAVgkplpcepltynadgrqsasvf-------------n 925
gi 502875372  915 VYQRKSDhsVYs---dARRARLFAGPAPRKLTAEQLVDSLFVASgksfrteelnidvdglrpmnqs-------------l 978
gi 502673525  864 TYQREPTssL-------AQSRLFAAPMRRRMTAEQVLDSMYSVAgkrlnveelnidvdgtrneaqs-------------i 923
gi 918008953  341 AYARSSQwvy---dtpAPPADQFAVAAIKPLTPQQLTVSLIIATmn---------------------------------- 383
gi 502677476  653 TYQLSWQ--TNETN--AKDERNFARAVPRRLPAEVAYDALITATasdtkaas---------------------------- 700
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81659555  1036 gstpatkqvfvqdhgeklyrRSLYTI----VKRTSPHP-----AMAAFD-APSRELCTMDR-------GATNTPIQALVT 1098
gi 81660772   528 kfketyfastykrnlnqhayQRNVLC----RASELPAPlpadhFLRQFG-QGDREVINGSQ-------DEATVP-QILAM 594
gi 122939685  385 ----------epftfipegqRSISLPdgsiTSA----------FLELFGrPPRDSGLEVER-------NNRLTAAQQLHL 437
gi 505059070  725 --lvdvgnasqtfggmplgtRAAQLP----DGDVYQHP-----FLSAFGqPARETSCECER-------GGDAGLVHALQL 786
gi 503393707  491 kalrqvtgkyryarekqfkhQGLLLV----RASELPQPlppshFLRQFG-QSDRETIEGNS-------DGGSVP-QILQM 557
gi 503394558  926 nfgvpkrawewvaisnererPSMNLP----KAQSVAD------LLAAFGwRSERQDPTTVR-------ELTPTPLTPLAL 988
gi 502875372  979 gfgfperawefvatnnerdrPSLALP----GVQSFIN------VLETFGwRASRPDPQSLR-------SQETTVLQPATL 1041
gi 502673525  924 slgipdrgwqftslsnerdrPSLSLP----GAQNMIN------VLEAFGwRGSRQDPMTMR-------ESEPAVIQPATL 986
gi 918008953  384 ---------------------peKIPssdfHEQGVDPN-----TWKSFRtELEKKASGTARlleypgeNFQISVTEALLF 437
gi 502677476  701 -------------mltelkgRATAIP----GASARSNNnpagfALQVFGrSIRESNCDCDR-------SMESSLLQTVYL 756
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81659555  1099 LNDPQFA-----------EAARVLAER--L----WTESasnet------------------------------------- 1124
gi 81660772   595 FNGPITHvmlepgsalvdNVLEVNNVK----------------------------------------------------- 621
gi 122939685  438 LNSSHVE-----------RKIEQSPKFqyLirnsRNGQ------------------------------------------ 464
gi 505059070  787 INGPSVK-----------DKLSRPENRigRllaaDRPDs----------------------------------------- 814
gi 503393707  558 FNGPLTHllldkksflvvNVTNQKDLE----------------------------------------------------- 584
gi 503394558  989 ANGAALN-----------RAVDVSDRGelVdlclSADSv----------------------------------------- 1016
gi 502875372 1042 ANGTLTL-----------RASQLSDDSliTelaiSSKSv----------------------------------------- 1069
gi 502673525  987 ANGVAAK-----------RIAQLSEDSrfTllalEDQPi----------------------------------------- 1014
gi 918008953  438 NNAAQIQnnylk--ssddRLVNFLSNQwkAqqtqEDLHarr--------------------------------------- 476
gi 502677476  757 QNDTSVLaaiegardswiEQLSKTSKK--LtdgsEVKAeeaskelarmkvrldrakkaddekqverieeriaelkkllpa 834
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|...
gi 81659555  1125 -----------svsdlDRIDQAFTLVVGRKPNDEERDAVQSLL 1156
gi 81660772   622 ----------------NRIDAIFLSVLTRKPSTEDRILASREL 648
gi 122939685  465 ----------------GLVSALYLMILSRYPTEEELKIVRAYT 491
gi 505059070  815 ----------------EVIEEVYLATLSRLPTSEERAAGVgyv 841
gi 503393707  585 ----------------DAVDTIFLSILARYPTEQERAIANAey 611
gi 503394558 1017 ---------------dSLIDSLFLRILSRPPRAEERAIYTELL 1044
gi 502875372 1070 ---------------eEFVEKVFQQLMTRAPSVQEKAMFVEFL 1097
gi 502673525 1015 ---------------eKFVEQVFVEMLARKPTAAESAIYVELL 1042
gi 918008953  477 --------------mdSLIQTSFEIVFTRRAEEDEVSMFRNYL 505
gi 502677476  835 kegdksdaaplvlkpeEVVRQVYLRTVSRPPTDEEMKRCLQFI 877
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap