Conserved Protein Domain Family
DDE_Tnp_ISAZ013

?
pfam07592: DDE_Tnp_ISAZ013 
Rhodopirellula transposase DDE domain
These transposases are found in the planctomycete Rhodopirellula baltica, the cyanobacterium Nostoc, and the Gram-positive bacterium Streptomyces.
Statistics
?
PSSM-Id: 311516
View PSSM: pfam07592
Aligned: 25 rows
Threshold Bit Score: 382.763
Threshold Setting Gi: 428021369
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123737691  92 ALLALVEPDQRGAPE-SP-L-RWTVKSTRRLAEQLTAR-GHP----VGADTVGGLLRAEGFSLQGTSRTTEGAR-HPDRD 162
gi 81499619   94 DIKSLVDPQTQTDPSfKStR-LYTRMTASVVRRQLIEQfGYSdkelPSSETIRRRLNDLGYTLKRVLKTKPIKK-IPETE 171
gi 81421064    3 ELRAVIQDNTAGSPT-VPgL-KWTHLSVAEIVRELFQR-GIK----VANEVVSRLLGEMGFKTRQQVKSKTKAP-SRDRD 74
gi 505010601  96 DLDSLVEPTSRGDPE-SP-L-RWSCKSLAKLASELKNM-GHK----VCSKTVSTLLKSMGYSLQGNRKTQEGKH-NPDRD 166
gi 503484741  91 DLEKIMEESTAGDPM-SL-L-KWTYKSTYAIAEELQSR-GYK----VSHDTVRRLLKESGYSLQANRKNLEGKS-GPERD 161
gi 530553947  91 DLEKIMDENTAGDNM-SL-L-RWSNKSTYRIADELKLI-GHK----IDPDTVGRILKENDYSLQSNIKNKEGGS-SEDRD 161
gi 504987835  93 AFLEVLKFQTAGDPM-NE-LiKWTNLTHKEIALGLKKA-GFI----VSLPIVSQLLKKHGYVKRKAQKKQTIGI-NKNRN 164
gi 389400098  81 AFLEVIKNHTAGSPM-DEtI-KWTNLSRPAIAEKLKEH-NFP----VSVTVVDQLLEKHHFHSRQAFKSEAGKKnIPQRD 153
gi 648230860  92 DLEHLINPVSKGDLA-SP-L-RWTCASVRTLSAELIRM-GHA----TSHRMVAELLHSSGYSLQSKRKRVEGQG-LGSRD 162
gi 530556871  99 RLQEIVDPFTGGDPM-SP-A-LWTSKSLRKLAVELQKE-GYD----ISYRTVRVILREMGYSLKSNRKKGEGAS-EPDRN 169
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123737691 163 DQFRYINERVKEFTAGGQPV-VSVDTKKKEVLGDYAVAGREWHRKGQPVRVRAHDFPEKGAQKAVPYGVYD--------L 233
gi 81499619  172 AIFEQVEQINTEADNDPHTLrISIDAKVAVKIGEFDRGGK----TRIPTTSLDHDFPTEMT--LIPYGIFI--------P 237
gi 81421064   75 EQFEKIEKSIEDYKNTGDPV-FSIDSKRKESLGEVHRSGDVI--ANQAAEVLDHDLPAYRDGEVTPHGIYD--------V 143
gi 505010601 167 QQFVHINRTVRQFQNQKHPV-ISVDTKKKELIGNYKNSGVEWEPSSSPTQVKVHDFVDPELGKAIPYGVYD--------L 237
gi 503484741 162 TQFRYVSSQAAKFIDAGDPV-ISVDAKKKELVGNYKNSGRTWRQKGQPELVNVYDFPSKAIGAAIPYGVYD--------P 232
gi 530553947 162 AQFRYINEKGKEFMNNGNPV-ISVDAKKKELIGEFKNPGRTWNKTGEATEVNVYDFPNLGVGKAAPYGIYD--------T 232
gi 504987835 165 AQFENIAILDTQYREAGNPI-ISFDTKKKEVLGNLYRPGTLY--TTEPLITLDHDFWSLGCGKVIPHGIYD--------C 233
gi 389400098 154 EQFKNIQRLNQKYHEEGHPV-LSMDVKKKELIGNFFRSGKLY--TQEPIRVNDHDFVSNSDGKVAPHGLYD--------I 222
gi 648230860 163 AQFEFINLKVNEALRTGQPV-IMVEAMTRELADQPKARGK------SAAADDDHGPVQVSHPAISASGSCDpdaacehaI 235
gi 530556871 170 DQFKHINSKVMEFLDGNQPV-ISVDTKKKELIGNFKNNGKEWKAPGEYDEVNVYDFMQFAEGKAVPYGIYD--------M 240
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123737691 234 AADTGWVSVGCDGDTAAFAVATLRRWWDGEGRHRYPTATRLLITADVGGANGYRVRAWKKELADLARTTGLQITVCHFPP 313
gi 81499619  238 EYNELFLFFVSSKLTADCIVDLLESWWQNV-KHRFAHIQKLVINQDNGPENHSRRTQFMKRVVDFSTSSQLTLQLAYYPP 316
gi 81421064  144 QENTGHVTVTTGSDTGEFAVASFQRYWEEVGSVQHASAKRILLLCDCGGSNSYRSNTLKHHLQELSNELGLPIQVAHYPV 223
gi 505010601 238 QHNQAWVSVGIDHDTASFAVETIRNWWFNMGKPLYPDSQHLLITADCGGSNSYRSRLWKLKLQEFAEQTGLTVHVCHFPP 317
gi 503484741 233 KRNEGVVNIGKSHNTAEFAVESIRQWWNLVGKYRYAGCKNLLICADGGGSNGSRNRGWKFFLQQLADEIGITITVSHFPP 312
gi 530553947 233 GRNEGMVNVGKSHETSEFAVESIRQWWFLMGKERYPDAKGLMICADGGGSNGSRNRGWKIHLRELVNQIGIPITVCYYPP 312
gi 504987835 234 QKNRGYVTLGNSKDTSEFACESIKNWWNNYGKAAYPNANSILAKCDGGGSNNANHYIFKQDLQKLVDEIGIEIRIAHYPP 313
gi 389400098 223 YRNIGYVTLTTSHDTSEFACECIRRWWLTYGKYDYSGSNSLLLLCDCGGSNNARYYIFKEDLQKLSDELKIKIRIAHFPP 302
gi 648230860 236 AHGKGRSGVLVDRDMAEFAVEVIQHWWHSMGRAIFPHPQRLLVIADIDGGDESTSRLWRTGLQKLSDETNLVISIHHFPP 315
gi 530556871 241 KLNEGYVNVGIDHDTAEFAVESIRKWWNHMGRKRYPDAKRLMITADGGGSNGSRVKLWKIELQRFATETGLEISVCHFPP 320
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123737691 314 GTSKWNKIEHRLFSRISTNWRGRPLTSHEVVVNTIGATTTRTGLSVHAELDPGSYP---TGLTVPDEVMDALP--LTAHD 388
gi 81499619  317 YHSKYNPIE-RCFGWLEQHWNGSLLDTVETVLNF-AQTLTFKGKNPVVTLVEKVYS---TGVKLTTSAMEEIEtqINRLP 391
gi 81421064  224 HCSKYNPIERREFSHVERAFSGRIFSTASDVAEAAESTSTQTGLNVTTAELPEFQPvrkSGKRVPKPPN------VEYDK 297
gi 505010601 318 GTSKWNRIEHRLFCHISQNWRGRPLDSLMVIVSLIGNTSTKHGLTVHAQVDPNQYQ---IGIKVSDEDFNAIA--ITKDT 392
gi 503484741 313 GTSKWNKIEHCMFSFISMNWRGKPLSSYETIIKLIGSTKTKKGLRIEARLDDRDYE---TGIKILDEDMARLK--ISVHE 387
gi 530553947 313 GTSKWNKIEHRMFSFISMNWRGKPLVNFETVIKLIATTKTRNGITVAARVDDKEYA---TGIKHSDKEMEKLR--IEPHL 387
gi 504987835 314 YTSKYNPIEHRLFPHITRACQGVIFTSLNLVKNLMEKTHTNQGLCVVVNVVDKIYE---IGRKVSDDFKKNLK--IVFDE 388
gi 389400098 303 YTSKYNPIEHRLFPHITRACKGVIFKSIEIVNDFVAKTKTSTGLKVFTSILDKNFK---TGRKVADDFKKNMR--IQFDE 377
gi 648230860 316 ATTRWSHIEHRLVATISPHLRNKPGVSHDVVVNLIVAAPAGTDSGENRERANEGLP---RGAELSYTEIENLL--LTADG 390
gi 530556871 321 GTSKWNKIEHRLFSLITKNWRGKPLISFEVIVNLIANTRTEKGLRVECSIDRDSYE---KGIKISKAEMSKLN--IRTDE 395
                        330
                 ....*....|.
gi 123737691 389 WHGPWNYTLAP 399
gi 81499619  392 NLKKWFVEIFA 402
gi 81421064  298 DLPDYNYTFNP 308
gi 505010601 393 FHGEWNYQISP 403
gi 503484741 388 LYPMWNYSIEP 398
gi 530553947 388 LHPKWNYTILP 398
gi 504987835 389 YLPKWNYRAVP 399
gi 389400098 378 YLPQWNYVALP 388
gi 648230860 391 LHGGWNDSIRP 401
gi 530556871 396 FHGERNYTISP 406
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap