Conserved Protein Domain Family
DUF1576

?
pfam07613: DUF1576 
Protein of unknown function (DUF1576)
This small family is found in several undescribed proteins. The alignment is distinguished by the frequent occurrence of conserved glycine and aromatic residues.
Statistics
?
PSSM-Id: 311524
View PSSM: pfam07613
Aligned: 65 rows
Threshold Bit Score: 129.204
Threshold Setting Gi: 524720510
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75543327   29 PISIFTGLKNIILQPDILITDYLEISGIGASFVNSATLCIIYILILIRLKVKLSGSIVAGLFTVCGFSLFGKNLLNVWPL 108
gi 81484241   15 HENIFIGMYKIITSPAVLVTDFIQVGGIGAAFLNAILIFSFNFFLVKSFKVKITGITIAAFFTVFGFSFFGKNILNILPF 94
gi 122641416  43 PTDNWSGLLTILTSPSNLLTDYFALGGFGSAFINVGILTLLSVLLAYRHKVILNGPLFASILTVTGFSFFGKNLYNSISI 122
gi 502642024  72 PGRLLEGTLAIISSPSNLLTDYFAIASAGAVFLNAGALTLASVILVRLEKTEFSGPIIAGIFTVFGFALFGKNLFNSIPI 151
gi 949568942  56 PIEIFDGMKVIMRSSGKLLTDYMELTSIGAAFFNSGLLTLLSVLMVRSQKITISGPLVAGILTVCGFSLFGKNLFNSIPI 135
gi 514554611  43 PTDNWSGLLTILTSPSNLLTDYFALGGFGSAFINVGILTLLSVLLAYRHKVILNGPLFASILTVTGFSFFGKNLYNSISI 122
gi 160428315  41 fHSVVNGFINIVLSPTILVTDFIQVGGIEAAFINVGLVGLLNIFIMRHYRLKLNGILIAAFFTVIGFSFFGKNLYNIIPI 120
gi 501247752  32 PTEIFNGLITIIKSPCTLITDYMYLANIGAAFFNAGLICLLSTLLSQNFKVVISGPGVAAIFTMTGFAFFGKNIFNTIPI 111
gi 501423609  14 eHSLLVDLYEIVKAPSVLITDYFVVGGLGAAMVNAGLVGLIGILLTKVSKVKVKGPIIAAIFTMAGFSFLGKNIINIWPV 93
gi 491367768  44 PQALWQGSLAILNAPSNLISDYFAIGNLGSAFLNSGLLTLISILLAKKQGTIISGPMIAAFFTISGFSFFGKNIFNSIPI 123
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75543327  109 FLGTWLYSKYQKEPFSKYILVALFGSTLSPAVSQLSFSGHFETSTGLIIGISLGIFMGFILPPISSYCLKMHEGFNLYNS 188
gi 81484241   95 YLGGILYSIYTSTDFSEHIVPIAFSSALAPFVSSIAFYGDISYETSYINAILIGVLIGFIVVPLARSLYDFHEGYDLYNL 174
gi 122641416 123 ILGVYLYAVFVNKPFSQYIMIGLFGSALSPVVSYITFGMRFPLLIGILLGNLAGIAIGLLLPPLAAQTLVFHRGFTLYNI 202
gi 502642024 152 TLGVFLYARLERKRFGDYQVESLFATALGPAVSYLAFGTGMPVWAGILLGWSVGIVLGMVVPPLSVHFKKFHHGLSLYNI 231
gi 949568942 136 TLGVMLYAKFERRPFSHFVLISLFGTALGPVVSEFAFGMGLEPWKGIALGYLIGIGIGLILPPLSSHFLSFHKGFSLYNI 215
gi 514554611 123 ILGVYLYAVFVNKPFSQYIMIGLFGSALSPVVSYITFGMRFPLLIGILLGNLAGIAIGLLLPPLAAQTLVFHRGFTLYNI 202
gi 160428315 121 YFGGYIYSINKKISFKDIIIPLMFGTALAPMVSEISFSGLLQPFWAIIVAVCVGIFIGFILVPLSSHMLKFHDGYNLYNI 200
gi 501247752 112 TIGVLIYSKIENTSKASVILPALFGSALGPLISEIAFNSSLSPVHSIIVSYLVGISIGIIMVPLSGAFLRFHQGYNLYNM 191
gi 501423609  94 FLGVYLYSLTQKEGLNNYILNALFGTALAPLVSSISITSDLGVTGGIIGGVIAGFIV----PPLAGHLLATHQGLNLYNI 169
gi 491367768 124 PLGVYLYSYIQQRPATQYSLVALFGSAASPVISYLAFGLGLPLPVGIAFGYGIGLLIGLALPPLAAQFLQFHQGFSLYNI 203
                        170
                 ....*....|....*.
gi 75543327  189 GFAAGLVGTFIMSILR 204
gi 81484241  175 GFTAGILGSVIIAVLK 190
gi 122641416 203 GFTSGLIAMTFTAVLR 218
gi 502642024 232 GFTAGIVGMVVVAIkn 247
gi 949568942 216 GFTSGIIGMFITAISR 231
gi 514554611 203 GFTSGLIAMTFTAVLR 218
gi 160428315 201 GFTSGILGTVLTSVLR 216
gi 501247752 192 GFTAGIVGMLYVGILR 207
gi 501423609 170 GFTAGFIGTLFTGIFR 185
gi 491367768 204 GFAAGIITMFFTSFLR 219
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap