Conserved Protein Domain Family
PSD2

?
pfam07624: PSD2 
Protein of unknown function (DUF1585)
A conserved sequence region at the C terminus of several cytochrome-like proteins in Rhodopirellula baltica.
Statistics
?
PSSM-Id: 311527
View PSSM: pfam07624
Aligned: 86 rows
Threshold Bit Score: 52.4991
Threshold Setting Gi: 769203813
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 81659196   856 NQQELAGVEGLKRYLlEHRQDQFVRGMVHKLATYALGRPLTFSDHSSIDEITAEVRQRGDGLATMIEQLVTSDLF 930
gi 283436555  635 DGT-VRDPRELVLRL--ADSDRVRQVFVRHAFRYFLGRNETLADARTLQQADRSYVESGGSFKALVVSLLTSDSF 706
gi 501193771  486 qpRSYADAVEFSQ-L-LAESSEAHGCYAERWLEFTHGRGARAEDRALVEELGEASRG-GASTKELIVRIVSSTPF 557
gi 161163453  501 DGVPVADARALGVTL--SESASVAECLVRKYYMYAAGHEERKVDKRVLDALTASFEGSGYKLRELVLDVVTNDAF 573
gi 501190953  460 GGAAFQDISGLIPEL--QKDPQLGICPSEQLFTYALRRRPFGGDRDALEAIAARWEK--GTIADLVKQVVTSEAF 530
gi 501194221  477 gdKSFADAGELMHY--MAEGEQAHLCYAKKLASFALQRDVVPSDLPLVETLAEVSRGASGSVKAIMLELVKKDAF 549
gi 501194217  484 qpRSYADAIEFSQ-L-LAESSEAHACYAERWLEFAHGRDADVKDKAFVEQLGEASRG-GSSTKELLLEIVSSTPF 555
gi 501194516  462 EGEAFEDISGLVPAL-V-EAARAGTCPSEQLFSYALRRRPSAGDRTRIKEIAARW--GGGTIADLAKQVVTSEAF 532
gi 501191884  489 pgivFSNFVELVDEL--AQKPDVYGCFAQQFAAYASGYDLPELDACEKERLVDEFARSQHAIDQLVLGVIASPSF 561
gi 502673484 1001 DG-DVKDAFDLIDRL--AKSDKVRQSIIRHAFRYFLGRNETLADSKTLIDAEKAYLQSNGSFDEVIVALLTSDSF 1072
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap