3H8M,1SGG


Conserved Protein Domain Family
SAM_2

?
pfam07647: SAM_2 
Click on image for an interactive view with Cn3D
SAM domain (Sterile alpha motif)
Statistics
?
PSSM-Id: 336753
View PSSM: pfam07647
Aligned: 48 rows
Threshold Bit Score: 37.2492
Threshold Setting Gi: 584850
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
3H8M_A         20 PDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSlESVARMTIEDVMSLGITLVGHQKKIMSSIQTMR 85
gi 341940894   12 VLAWNSDNLADYFRKLNYRDCEKAVKKYHIDG-ARFLNLTENDIQKFPKLRMPLLSKLSQDINKNE 76
gi 384872320  271 SPYTAFGDLEIFLHGLGLEHMTDSLKEKDITL-RHLLTMKKDELTKNGIASKDQ-QKILAALKELE 334
gi 226693566 1024 VAGLDM-NISQFLKSLGLEHLRDIFETEQITL-DVLADMGHEELKEIGINAYGHRHKLIKGVERLL 1087
gi 20140805   871 VPGVDF-SITQFVRNLGLEHLMDIFEREQITLdVLV-EMGHKELKEIGINAYGHRHKLIKGVERLI 934
gi 294862533  938 LDFPCLDSPQAWLSAIGLECYQDNFSKFGLSTfSDVAQLSLEDLPGLGITLAGHQKKLLHNIQLLQ 1003
gi 125338     908 VDIATFHTTGDWLNGMRTAHCKEIFTGVEYSScDTIAKISTDDMKKVGVTVVGPQKKIISTIKALE 973
gi 74871026   173 EHPTLSPRVKSLLDRTGNAHLTELFTRQEIDIeVLI-QMTLEDLAALGVRGAREIRLAMNIIQLAK 237
gi 57013009   541 PPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTiYQIEHYSMDDLASLKIPEQFR-HAIWKGILDHR 605
gi 221040946   34 PPYHADPSLVSFLTGLGCPNCIEYFTSQGLQSiYHLQNLTIEDLGALKIPEQYR-MTIWRGLQDLK 98
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap