3ZYK


Conserved Protein Domain Family
ANTH

?
pfam07651: ANTH 
Click on image for an interactive view with Cn3D
ANTH domain
AP180 is an endocytotic accessory proteins that has been implicated in the formation of clathrin-coated pits. The domain is involved in phosphatidylinositol 4,5-bisphosphate binding and is a universal adaptor for nucleation of clathrin coats.
Statistics
?
PSSM-Id: 336756
View PSSM: pfam07651
Aligned: 29 rows
Threshold Bit Score: 239.511
Threshold Setting Gi: 46396002
Created: 26-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3ZYK_A         31 KTVCKATTHEiMGPKKKHLDYLIQCTNEMnVNIPQLADSLFERTTNS-SWVVVFKSLITTHHLMVYGNERFIQYLASRNT 109
gi 74590078    10 TSVKKACNAD-EVPPKRKHVRACIVYTWD-HKNSRAFWNAVKIQPLQsNEVQLFKALIMIHKVLQEGHPNTLKDGYRNRD 87
gi 384872634   19 TSVRKATSID-ETAPKRKHVRSCIIFTWD-HHTARPFWTAIKVQPLLaNEVQTFKALITIHRVLQEGHKSALVDSQSEKG 96
gi 74618053    18 INIRKATSAE-ESAPKRKHVRSCIVYTWD-HKSSQSFWAGMKVQPIMaDEVQTFKALITIHKVLQEGHPATLREAMANRG 95
gi 74604589    12 VNIKKATNTD-ESAPKRKHVRACIVYTHD-HRSSKAFWNGIRIQPLQtDDVMVFKALITIHKVLQEGHPSALRDAQANVN 89
gi 206729937   42 VSINKAINTQ-EVAVKEKHARTCILGTHH-EKGAQTFWSVVNRLPLSsNAVLCWKFCHVFHKLLRDGHPNVLKDSLRYRN 119
gi 13431563    33 ISISKAINTQ-EAPVKEKHARRIILGTHH-EKGAFTFWSYAIGLPLPsSSILSWKFCHVLHKVLRDGHPNVLHDCQRYRS 110
gi 74960188    12 QAVQKAITKD-ETPLKPKHLETILLGTHT-EKSSAIFWSSVKKIKLEnHPVLTWKFCLLVHKLLRDGHPVVPKEAYRNEK 89
gi 74865864    14 VSVSKALNGL-EAPLKTKHARSIIIMIHK-AKEAKTFWMIISRQPLMqSRFTAWKFSHLLHKVLREGHESAIRHSQSHKK 91
gi 207341898   10 KALKKACSVE-ETAPKRKHVRACIVYTWD-HQSSKAVFTTLKTLPLAnDEVQLFKMLIVLHKIIQEGHPSALAEAIRDRD 87
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3ZYK_A        110 LFNLSNFLDK---SGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFD----FTKVKRGa------DGVMR----T--MNTEK 170
gi 74590078    88 FIASLATVFP-----SHGSAYGRLINQYDKYILQKLDFHRNNPGFng-tFEYEEYIslr-avnDPNEGye-aL--LNLMD 157
gi 384872634   97 WLKTCERqy---dGESSPKGYSDLIRDYVDYLLDKLSFHAQHPEFng-tFEYKEYIslr-qvdDPNEGye-tV--YDMMN 168
gi 74618053    96 WIDSLNRGMG----GEGMRGYGPLIKEYVYYLLAKLSFHQQHPEFng-tFEYEEYIslk-ainDPNEGye-tI--TDLMT 166
gi 74604589    90 FIQSLARGNNytgPNQGNHGYGKLISEYVRFLMQKLTFHKYHPAFng-mFEYEDYIslr-tvnDPNEGye-aI--MNLMT 164
gi 206729937  120 ELSDMSRMWG-----HLSEGYGQLCSIYLKLLRTKMEYHTKNPRFpg-nLQMSDRQlde-ageSDVNNffqlT--VEMFD 190
gi 13431563   111 NIREIGDLWG-----HLHDRYGQLVNVYTKLLLTKISFHLKHPQFpa-gLEVTDEVlekaagtDVNNIfq-lT--VEMFD 181
gi 74960188    90 RFTQLALHWK------DKRDYGPCIDAYCKLLHDRVIFHHKRPYFpg-nLFVSPLQldt-mgrDLSRMlr-lT--GDMMH 158
gi 74865864    92 MILEVGKMWG-----LLQDDIGCCIQAYSKLLATKLNFHDKNRMFpg-tLNISFTElfi-avdRDLnycfqlC--VEIFD 162
gi 207341898   88 WIRSLGRVHSg--GSS----YSKLIREYVRYLVLKLDFHAHHRGFnngtFEYEEYVslv-svsDPDEGy---EtiLDLMS 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3ZYK_A        171 LLKTVPIIQNQMDALLDFNVNSNELT--NGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMkkNQCKEGLDIYKKFL 248
gi 74590078   158 LQDSINDLQKLIFATIN-----QSHS--NLCKVSALVPLIAESYGIYKFCISMLRAMYQQLGED-----DALSGLVERFD 225
gi 384872634  169 LQDHIDEFQKQLFSNFK-----RSNK--NECRIAALVPLVQESYGIYRFLTSMLRALYSTVDAP-----ETLEPLKHRYK 236
gi 74618053   167 LQDKIDQFQKLIFSHFR---NVGNN----ECRISALVPLVTESYGIYKFITSMLRAMHSSTGD-----AEALEPLRGRYD 234
gi 74604589   165 LQDGVDDFQRLVFSSLQ-----RSRS--NECKISSLVPMIAESYGIYRFVISMLRAMHVSTGN-----DEALESLRQRFY 232
gi 206729937  191 YLECELNLFQTVFNSLDMSRSVSVTAa-GQCRLAPLIQVILDCSHLYDYTVKLLFKLHSCLPA------DTLQGHRDRFM 263
gi 13431563   182 YMDCELKLSESVFRQLNTAIAVSQMSs-GQCRLAPLIQVIQDCSHLYHYTVKLLFKLHSCLPA------DTLQGHRDRFH 254
gi 74960188   159 QMDSLLAFQEKVYLLSNSSPRWDPNTpqGQCLMLPLISVIMDTWPFFIYIVRMMYNLHSNVSP------HELEGYRSRFQ 232
gi 74865864   163 YLEDIIALQLTIFSSME-KYRMSSMTpqGQCRLAPIVCLIQDSNALYDLSVRLMFKLHDGVPY------DVVSGHRDRFH 235
gi 207341898  158 LQDSLDEFSQIIFASIQ----SERRN--TECKISALIPLIAESYGIYKFITSMLRAMHRQLNDA--EGDAALQPLKERYE 229
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....
3ZYK_A        249 TRMTRISEFLKVAEQVGIDRG-D-IPDLSQAPSSLLDALEQHLA 290
gi 74590078   226 SQHFMLRDFYTDCHAIKFLTSlItIPRLPNSAPNLKVTDDGqpi 269
gi 384872634  237 SQHHRLRQFYADCSNLRYLTSlIsVPRLPHDPPD-LEGDDNIPD 279
gi 74618053   235 AQHYRLVKFYYECSNLRYLTSlItIPKLPQDPPNLLAEDENAPA 278
gi 74604589   233 SQHDRLRDFYYDCSTLKYLRSiVtIPQLGKNPPNLLEEEDgpgl 276
gi 206729937  264 EQFTKLKDLFYRSSNLQYFKRlIqIPQLPENPPNFLRASALSEH 307
gi 13431563   255 EQFHSLRNFFRRASDMLYFKRlIqIPRLPEGPPNFLRASALAEH 298
gi 74960188   233 TIFEKTKQFYEECSKHQYFRCfVqIPTFPLHAPNFFTQSDLESY 276
gi 74865864   236 GLFLKLKSFYNNVRPLQYFKDlItIPELPDSSPNFKSQNDFTSY 279
gi 207341898  230 LQHARLFEFYADCSSVKYLTTlVtIPKLPVDAPDVFLINDvdes 273
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap