Conserved Protein Domain Family
DoxX

?
pfam07681: DoxX 
DoxX
These proteins appear to have some sequence similarity with pfam04173 but their function is unknown.
Statistics
?
PSSM-Id: 311556
View PSSM: pfam07681
Aligned: 88 rows
Threshold Bit Score: 30.2259
Threshold Setting Gi: 81654686
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81420613  20 LPLLARISLAATFWLSGQSKVVglnidiletrtpwqlgipRVTD----------SSVSLFtneyKLPLLP--PDVAAVMA 87
gi 81540003  14 LWLTARICLALMFVASGLAKLF------------------DYQA----------SLEEMR----AAGLEP--AWLFNIAT 59
gi 81735088  19 LWHAARLALVSAYLLGGFIKLL------------------DFAG----------AVAEQE----HFGLYP--GWLWATAA 64
gi 75403767  25 TVAL--LALCSAYIQGPLTKIF------------------DFPG----------AIAEMN----HFGLQP--AAAFAVFV 68
gi 81635622  25 FLAL--LALCSAYIQGPLMKIY------------------DFEG----------AIAEMN----HFGLTP--APLFAVGV 68
gi 81545868   4 LRLAGRPMLASMFVAGGLQSLR------------------RPQDvapaaepvvrPVADRV----PVLPDS--TEQLVRLN 59
gi 81737422   4 FVTFGRILFAVLFIYTGATKLFaiqatadfiatkvvvpdiIAPY----------AKQIET----ATAMTT--PQLLAIAV 67
gi 81771076   6 IPLVARSFLAVIFIYAGVNKVF------------------NFAQ----------TSESMA----KAGLPI--VGVLLIFT 51
gi 81664470   9 LDFLGRVFLASTFVVAIPSKFL------------------NYPV----------VLNTII----QKGIPEtqANILLVAA 56
gi 81577687  10 VDFIGRLCLSAVFVVAVPSKIT------------------KFSS----------VVEAIS----GQGIPEslAPFLLLAA 57
                        90       100       110
                ....*....|....*....|....*....|....*..
gi 81420613  88 ATAEHLFPLLLIVGLATRFSALALMVMTLVIQIFVYP 124
gi 81540003  60 AVTLLAGSALVLLDRKLWLGAGALAVFLLLTILIVHT 96
gi 81735088  65 IVVELGGSLLVVVNRFVWLGAGGLGILTFVAMLTANA 101
gi 75403767  69 IIFELTASAMVVTGVLRWVGALALSGFTLLATFIALR 105
gi 81635622  69 IVFELAMSALILLGIFRKVAALCLAVFTVAATFLAFR 105
gi 81545868  60 GAVHVVGGIMLGLGRCPRLAALALAVTLVPTTLAAHR 96
gi 81737422  68 GALEIIAGLMIALNFGARFFAMLLIVYVAVATVLFYD 104
gi 81771076  52 IAFQILGGLSIILGYKAEIGAILLIIFLIPATIVFHN 88
gi 81664470  57 IFLLISGSLALVFGKDQKIGAIFLLIFLVPTTIIFHL 93
gi 81577687  58 IACLIVGSVLLLFGKSQKLGASLLLIFLVPTTVIFHA 94
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap