4U0V,4ZSI,3DDV,2PKH


Conserved Protein Domain Family
UTRA

?
pfam07702: UTRA 
Click on image for an interactive view with Cn3D
UTRA domain
The UbiC transcription regulator-associated (UTRA) domain is a conserved ligand-binding domain that has a similar fold to pfam04345. It is believed to modulate activity of bacterial transcription factors in response to binding small molecules.
Statistics
?
PSSM-Id: 336774
View PSSM: pfam07702
Aligned: 154 rows
Threshold Bit Score: 79.9444
Threshold Setting Gi: 81722357
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4U0V_A       98 SRGMTPGSRLIDYQLIDSTEELAAILGCGHPSSIHKITRVRLANDIPMAIESSHIPFELAGELNESHFQSSIYDHIERyN 177
gi 81783687  90 AQGRQPRTETLHAERRAAGAWLAKRMGLEDSAPVYFLQRRRWVDERPVLIELIALDAGWCPGLLDHDLDTSLMSLLRErF 169
gi 81726384  86 AQNRVPKTELIAAKGTLANKQSARLLQLQPFSDVFRVDRVRYLEDRPVVYVTNYIRPEIFPNLLSFDLTNSLTDIYREhF 165
gi 81788360  86 AQNRQPKTELVSAKAVIANKQATRLLKLKPFSDVYRVDRVRYLDNRPVVYVTNYIRPELFPNLLDFDLSQSLTDLYREhY 165
gi 81726284  96 EQHRIAATQLISVRSEMAAGDYAKALDIEQMTPIHIIERLRCIDGRAVLFVENVLKASLFDGILAENLTMSLTGIYREkY 175
gi 81733455  92 DQGRVASTELLSARLQPASAAICARLQLPALSSVVRVCRLRRIDGRAVLYAEHYLNPRYFPGILEHDLAQSLTEIYGRvY 171
gi 81783821  92 DQGRVPETEVLGAAMIPASVDICQRLELPALSRVFQIRRARRVDGRLVLYVEHYLNPAYFPGIERFDLTRSLTDLYANhY 171
gi 81783663  92 EQGRVPATEVLSARQMPASAAVCELLELPALSSVYQIRRARRVDGRLVLYVEHYLNAQYFPGILGHDLTRSLTELYASeY 171
gi 81730143  92 AQGRVAHTQLLSARLQPASAMICEMLELPALSSVIQICRARRIDQRLVLYVEHYLRPELFPGILDHDLNESLIELYARcY 171
gi 81706925  94 EQGREPKTALLSGVLTTVPVEVMEPLQLQPFDQIYLLTRLRYADGRAVCYCENHCLPARVPELLQYDLNGSLTEVYEShY 173
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|
4U0V_A      178 SIPISRAKQELEPSAATTEEANILGIQKGAPVLLIKRTTYLQNGTAFEHAKSVYRGDRYT 237
gi 81783687 170 GLQPTRCQLAMHPTALNAAQAEPLQLAPGSPALYLERLSYAEGQRVVEFDQEFWRPDALE 229
gi 81726384 166 GVVYQKTRYRISTSTLLGEVAQALRATSGTPAMVVERTNYNQHGELIDCDIEYWRHDAIS 225
gi 81788360 166 ATQYQTIHYRISTSSLLGEMAQALRATSGTPAMVVERVNYNQKGELIDCDIEYWRHDAIT 225
gi 81726284 176 GYETMRSRFDVIPTSAPAHVAKALNLAEGQPVLKICRVNYKQDGELMDCELEYWRPDAVM 235
gi 81733455 172 GIEYGQVCFEILPTALPVEAASALKVSAGSPGLHITRVNSDQHGHLIDCDLEYWRHDAIR 231
gi 81783821 172 GIRYGRVRFEMVPTILPAEAAGPLRVSVGSPALQIVRVNRDQAGRLIDCDLEYWRHDALQ 231
gi 81783663 172 GIHYGRVRFDMVPTALHAEAAAPLKVAVGSPALRISRINRDQRGRLIDCDLEFWRHDAIH 231
gi 81730143 172 DVHYGPVRFDVVPTALHADAAAALKVSLGSPGLRIARVNYDRKDRLIDCDLEYWRHDAIH 231
gi 81706925 174 NLVYTSMHLSFYPTAMPAQAAQALGVMEGRPALLLRRLNYDQHGRVLDLDIEYWRHDSLR 233
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap