Conserved Protein Domain Family
BACK

?
pfam07707: BACK 
Click on image for an interactive view with Cn3D
BTB And C-terminal Kelch
This domain is found associated with pfam00651 and pfam01344. The BACK domain is found juxtaposed to the BTB domain; they are separated by as little as two residues. This family appears to be closely related to the BTB domain (Finn RD, personal observation).
Statistics
?
PSSM-Id: 311578
View PSSM: pfam07707
Aligned: 72 rows
Threshold Bit Score: 67.9556
Threshold Setting Gi: 74804852
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3HVE_A       136 CIGIRDFALHY-CLHHVHYLATEYLETHFRDVSSTEEFLELSPQKLKEVISLEKLNVGNERYVFEAVIRWIAHDTEIRKV 214
gi 74956702  170 LCSIFNAAYFF-QFTDLIDYCMQYSDKHADQLLEDPSFNRLSGDSLKELLARDSF-FALELKIFNAVRSWHQNNPT-MKE 246
gi 74804852  148 VCAILDAARLF-ALDGLTAVCHSFMDRNAADILQHESFRHLSLDSLCSLLLRDSF-FAREVEIFQAVFDWCRCNAD-TVP 224
gi 74872407  150 VCMILDAARLY-NLEELTEVCLMFMDRNAGDLLLHNSFNTLSKESLEEVLRRDCF-FAPEVQIFLAVWKWSRFNSN---V 224
gi 74958081  153 ALSIREFCKMMcVEEKITEMTDDYIQKHFMAVSKDEDFKRLSLEDAIELLRNDHLYVDSEEQVYVAAMEWLNCDVI-RHE 231
gi 137403    123 CIDFYIYADKY-NNKKIESASFNTILQNILRLINDENFKYLTEESMIKILSDDMLNIKNEDFAPLILIKWLESTQQ---S 198
gi 81996899  125 CLQVYMFSKVH-NLFRLMDVALSTIIMNITTIYKHDNFGLLDEKDIELILGSDYLNIIDEDISVVILFNWLRYN--NVTR 201
gi 74872739  306 AFQAYIMAKDY-RCPEIMIVMQSRLRKCFLPIVASWEFLEFDVNEVTTLLEQDMLCVNSEDEIFFAVFHWLNYSWTERKK 384
gi 966670442 112 CVAVHSLAHMY-TLDQLALRAADMIRRNFHKVIQDEEFYTLPFHLVRDWLSDAEITVDSEEVLFDAVVKWVQKNSEERVK 190
gi 24651875  224 aamLYFEAKIL-KLEVIHLQYLERVSKFFLTLVASKEFLRLPLKSMLLLIQSDLIGVNTELEVFMAAARWLSHHWPQREE 302
                         90       100
                 ....*....|....*....|..
3HVE_A       215 HXKDVXSALWVSGLDSSYLREQ 236
gi 74956702  247 ASKVLLELVRLPLITQTELLNC 268
gi 74804852  225 NVDVVVGKVRFELMSLEELLTV 246
gi 74872407  225 DFKSVVSYVRLPLMNLEHLLQV 246
gi 74958081  232 QAAKILPCVRLPLLSPTYLSSI 253
gi 137403    199 CTVELLRCLRISLLSPQVIKSl 220
gi 81996899  202 CPLSILAKIRLSLLSNQ-VSKF 222
gi 74872739  385 HAVKVMQKVRFGLLSP-WLRRS 405
gi 966670442 191 YFEELFRLLRLPQIKPTYLTRV 212
gi 24651875  303 NVTDVVSSIRFGLIPPWLLIRl 324
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap