Conserved Protein Domain Family
RVT_2

?
pfam07727: RVT_2 
Reverse transcriptase (RNA-dependent DNA polymerase)
A reverse transcriptase gene is usually indicative of a mobile element such as a retrotransposon or retrovirus. Reverse transcriptases occur in a variety of mobile elements, including retrotransposons, retroviruses, group II introns, bacterial msDNAs, hepadnaviruses, and caulimoviruses. This Pfam entry includes reverse transcriptases not recognized by the pfam00078 model.
Statistics
?
PSSM-Id: 311594
View PSSM: pfam07727
Aligned: 30 rows
Threshold Bit Score: 298.729
Threshold Setting Gi: 74587170
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75229788   781 NGTWELVHLLKQK-KPVHCKWIFKRKEGLSPsGPPRFNARLVAKGFSQIAGVDYN--DVFSPVVKHSSIRTFFCIVAMHD 857
gi 75162634   472 NGTWEVTERPCGC-KPVGCKWVFKKKLRPDG-TIKKYKARLVAKGYTQKEGEDFF--DTYSPIAGLTTIRVLLSLAASHG 547
gi 75146009   398 NGVWDLVEIPKGS-KTVGCKWVYKTKLDSKG-KIERFKARLVAKGFSQREGIDYN--ETFSPVSKKDSFRIVMALVAHYD 473
gi 75143437   915 NDVWDLEEIPKGA-KTVGCKWVYKTKYDSRG-NIEKFKARLVAKGFTQREGIDYN--ETFSPVSCKDSFRIIMALVAHYD 990
gi 75157271   880 NHTWEFVKLPKEK-KPIRCKWIFKRKEGMSPsDEARYKARLVAKGYSQIPGIDFN--DVFSPIMKHSSIRTLLGIVAMHD 956
gi 75232770   465 RDVFLPVMPTCRGfFPVGYKWVFVRKRNENN-EVVRYKARLVAQGFTQKSGDDFN--ETYSPVMSGITFRYLISLAVQNR 541
gi 74591449   888 NQVYTVEKTPKNV-VPLKTMWVHTYKTNDL--KNHNYKSRCVVMGNYMVENRDFDphAISSPVVDLTSIRLLSAIAVENN 964
gi 74588548   999 NNTWSLEPLPEGR-KAIGVKWVYTIK------DTGRYKARLVALGYRQQAGVDFL--ETYAPVIRGESIKLIFALASKSK 1069
gi 323347569  145 hKTYRLVSLPKQR-RALGSRWVFTIK------DSGKYKARLVAQGHTQKAGIDYQ--ETFAPVIRYDSVRLFLALASCLK 215
gi 294659635 1015 NNTWDLVSLPKDR-KAIGNRWVFTKKDD------GRYKARLVAQGFSQVPGEDYL--DTFSPVIRYESVKLLLAFSAVDN 1085
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75229788   858 LELEQLDVKTIFLHGELEEE--IYMDQPEGFIVPGKEDDVCKLKRSLYGLKQSPRQWYKRFDSFMLSHGFKRSEFDSCVY 935
gi 75162634   548 LLVHQMDVKTAFLNGELDEE--IYMDQPNGFVVEGQEGKVCKLLKSLYGLKQAPKQWHEKFDKTLTSAGFAVNEADKCVY 625
gi 75146009   474 LELHQMDVKTAFLNGELHED--VYMAEPEGFVMEGKDHLACKLKKSIYELKQASRQWYLKFDEIIKRFGFKENEVDNCIY 551
gi 75143437   991 LELHQMDVKTAFLNGDLEEK--VYMAQPKGFVMKGNENMGCRLKRSIYGLKQASRQWYLKFDGTIKKFGFQENVEDNCIY 1068
gi 75157271   957 YELEQMDVKTAFLHGELEED--IYMEQPEGFVVLGKENLVCRLKKSLYGLKQSPRQWYKRFDSFMLSQKFRRSNYDSCVY 1034
gi 75232770   542 IVMQLMDVVTTYLYGSLDSD--IYMKVLDGIDIPNQ-------KKSLYGLKQSDRMWYNRLSEILSLKGYTKNDDFPCVF 612
gi 74591449   965 LVMHQLDIASAYLNASLEDGrvIFVRPPRGFEVK--PGYSWRLHKSVYGLRQSAHNWYSHFKNVLEANGLKQTLHNDGIF 1042
gi 74588548  1070 LKIHSIDVTTAFLNGEISEL--IFVKQPPGYEDKKRPNHVCKLNRSLYGLKQSPLMWNIKLNDVLIKEGFRRLGGDLGIY 1147
gi 323347569  216 LIVYQMDVDTAFLNSTMDEP--VYVKQPPGFVNERNPDYVWELYGGMYGLKQAPLLWNEHINNTLKKIGFCRHEGEHGLY 293
gi 294659635 1086 RVVHQMDVDTAFLNGTVEET--LYMKQPVGFINENEPEKVCKLNKSLYGLKQAPICWNTTISDFLAEHRFNRIDTELGIY 1163
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75229788   936 IKFVNGSH-IYLLLYVDDMLIAAKSKEQITTLKKQLSSEFDMKDLVASKKILGMEITRdiNSGL-LFLSQQSYIKKVLQR 1013
gi 75162634   626 YRHGGGEG-VILCLYVDDVLIFGTNLEVINEVKSFLSQNFDMKDLGVVDVILNIKLIR--GENG-ITLLQSHYVEKILNR 701
gi 75146009   552 IKTKGGKF-IILVLYVDDILLASSDINMLHQTKEFLSSNFDMKDLGEASYVLGIEIHRdrSKGV-LGLSQKSYISRVLKR 629
gi 75143437  1069 SKFKNGRF-IFLILYVDDILLASSDVSLLQETKKFLSSNFDMKDLGEASYVLGIEIHRdrTKYA-LGLSQKTYIEKVLKK 1146
gi 75157271  1035 LKVVDGSA-IYLLLYVDDMLIAAKDKSEIAKLKAQLSSEFGMKDLGAAKKILGMEITRerHSGK-LYLSQKGYIKKVLRR 1112
gi 75232770   613 IKKSPTGF-CFISVYVDDLNIIRNTQD-INEACHHLKTEFEMKDLGQTKFCLGLQLDH--LPSR-ILVHQSAYTQKILEK 687
gi 74591449  1043 WKNYENGDvLYVSVYVDDVFMIATNEKIIKEFVAMLETYFQLQYFGEATEYLGIQFRK--TPDG-YTLDQIPFLEKLVAT 1119
gi 74588548  1148 ISKDK--R-TIMGVYVDDILICGPSDSEIEQVKNNVRKYFSITDNGLCRKFLGINVYQ--QANE-IRLSLNDYIRRMIEE 1221
gi 323347569  294 FRSTSDGP-IYIALYVDDLLVAAPSPKIYDRVKQELTKLYSMKDLGKVDKFLGLNIHQ--SSNGdITLSLQDYIAKAASE 370
gi 294659635 1164 VRGN-----IIIGLYVDDILISGKDMKEIEDVKKMLASKFKMKDLGVAKKFLGINIAQ--DTNG-IKICLYDYIGKVLQD 1235
                         250
                  ....*....|....*...
gi 75229788  1014 FNIH--DAKPVSTPIAPH 1029
gi 75162634   702 FGYI--DSKPSPTPYDPS 717
gi 75146009   630 YNMS--KCSATPAPIVKG 645
gi 75143437  1147 FNMY--RCSATPAPIMKG 1162
gi 75157271  1113 FNMH--DVKPFGRSRDGF 1128
gi 75232770   688 FNMD--KSYPSKTPMVVR 703
gi 74591449  1120 FNIQ--DSYGKDIPIIpk 1135
gi 74588548  1222 LKLSvsETNPVSIPSdvn 1239
gi 323347569  371 SEIN--TCKLTQTPLcns 386
gi 294659635 1236 FEMT--DANTVTTPtlag 1251
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap