3F2B


Conserved Protein Domain Family
DNA_pol3_alpha

?
pfam07733: DNA_pol3_alpha 
Click on image for an interactive view with Cn3D
Bacterial DNA polymerase III alpha subunit
Statistics
?
PSSM-Id: 311600
View PSSM: pfam07733
Aligned: 90 rows
Threshold Bit Score: 341.771
Threshold Setting Gi: 81846181
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3F2B_A       417 EEIREMSYRRAKEIYGDPLPKLVEERLEKELKSIIGHGFAVIYLISHKLVKKSLDDGYLVGSRGSVGSSFVATMTEITEV 496
gi 81846181  836 DKLKQLIYQKSYSIFGDAMNNDVKARIDREISSVIDNGYAMIYWFSHLLVKQSVDDGYVVGSRGSVGSSVAAWLVDITEV 915
gi 13959345 1015 ERIVRLTYEKAHEWYGNPLPDIIDARLEKELRSILGNGFSVVYIISQELVKRSNDRGYIVGSRGSVGSSLVATMIGITEV 1094
gi 6225287   755 EIVRNLTMKRAYEIYGDPLPEIVQKRVEKELNAIINHGYAVLYLIAQELVQKSMSDGYVVGSRGSVGSSLVANLLGITEV 834
gi 81854710  831 QTIKDIAYEKAHELYGDPLPEIVQQRLDKELESIIKNGFSVMYIIAQKLVWKSNEDGYLVGSRGSVGSSFVANMTGITEV 910
gi 24418364  788 EELRRITLEKAHEIYGDPLPPIVQERLDRELNAIINNGYAVMYVIAQKLVSKSLQDGYLVGSRGSVGSSLVATMSGITEV 867
gi 24418366  835 EEIRNMTMNKVHSIYGENLPEVVQKRLDKELNSIINNGYAVLYLIAQKLVAKSLEDGYLVGSRGSVGSSFVATMSDITEV 914
gi 14424449  814 IKLKKLVYENAWKKYGKNLPEIIEQRIEKELTPILNYGFDVIYWISSILVQKSLSDGYLVGSRGSIGSSLVATLSGITEV 893
gi 13959349  820 QKTIDYVYHTAKKIYGENLPTIVEQRIKKELNSIIKHGFSVVYWISHLLVEKSMQDGYGVGSRGSVGSSLVATFLNITDV 899
gi 81834152  873 DKLIELVWNKAKELFGDEINPIIKSRIEYELNAIIKNGYGIIYWLAHLLVKKSNDDGYLVGSRGSVGSSIVALLAGISEV 952
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3F2B_A       497 NPL--------------------------------------Pphyvcpnckhseffndgsvgsgfdlpdkncprcgtkyk 538
gi 81846181  916 NPLephyictnckyfnfeknv--dsgfdlpesncpkcksklKgd------------------------------------ 957
gi 13959345 1095 NPLaphyrcpecqyfecyddgsfgsgydmpdkncpkcdhklIkd------------------------------------ 1138
gi 6225287   835 NPLpphyrcpeckyfevveddrygagydlpnkncprcgaplRkd------------------------------------ 878
gi 81854710  911 NSLpphyrcpkckysdfsdygv-kngfdlpdktcpvcgeplTkd------------------------------------ 953
gi 24418364  868 NPLpphyvcpkckhsefvtdgsfgcgvdmpdkycpncgtlmKkd------------------------------------ 911
gi 24418366  915 NGLpphyvcpnckkseffldgsissgadlpdkncpdcgakyIkd------------------------------------ 958
gi 14424449  894 NPLaphyicskcqyfelvkdpmtnsgfdlddkkcpkcnsflDkd------------------------------------ 937
gi 13959349  900 NPLtphylcpnckkcefitna--ddgfdlapksceqcqtpmLtd------------------------------------ 941
gi 81834152  953 NPLqpyyyckkckktkfvdnvddghdlvnkpcelldcdgemRge------------------------------------ 996
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3F2B_A       539 kdgHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKVLFGEDNVYRAGTIGTVADKTAygfvkayas---dhnlelr 615
gi 81846181  958 --gHNIPFETFMGFKGDKIPDIDLNFSAVYQGKAHDFIKNMFGEERVFRAGTISTTAEKTAygyvksyfee--skkmnar 1033
gi 13959345 1139 --gHDIPFETFLGFKGDKVPDIDLNFSGDDQPLAHLDVRDIFGEDYAFRAGTIGTVAEKTAfgfvkgyer---dydqfyg 1213
gi 6225287   879 --gHGIPFETFMGFEGDKVPDIDLNFSGEYQERAHRFVEELFGKDHVYRAGTINTIAERSAvgyvrsyee---ktgkklr 953
gi 81854710  954 --gIDIPFETFLGFNGDKEPDIDLNFSGEYQAKAHRYTEVIFGKGTTFKAGTIGTIAEKTAfgyvkkyye---eksipvn 1028
gi 24418364  912 --gFDIPFEVFMGFEGDKEPDIDLNFSGEYQPIAHRYTEELFGKGHVFRAGTIGTLADKTAygyvkkyfe---ernltvh 986
gi 24418366  959 --gHDIPFETFLGFEGDKEPDIDLNFSGEYQAVVHKYTEVLFGKGYVFKAGTIGTVAEKTAygfvkkylq---erglvvs 1033
gi 14424449  938 --gQTIPFETFLGFKADKVPDIDLNFSGEYQGKIHDEVKRLFGSKHTFRAGTISTVAEKTAygyikkyle---tasldys 1012
gi 13959349  942 --gHNIPFETFLGFDGDKVPDIDLNFSGVYQAVAHNFIKSIFGETHSYRAGTIGTMAQTSAentvkkyfenrfnenkiir 1019
gi 81834152  997 --gHNIPFASFMGFKGEKTPDIDLNFSSFYQAKAHDYVRELFGESHTTRCGTISTMQDKTAykiakdyl------eitig 1068
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3F2B_A       616 gaEIDRL----AAGCTGVKRTTGQHPGGIIVVPDymEIYDFTPIQY-PADDTS--SewrTTHFDFHSIHDNLLKLDILGH 688
gi 81846181 1034 naEITRI----AKKCENVKRTTGQHPGGIVVVPHgkDVYDFTPFNYpADDKTQdwF---TTHLAFESLHDSLLKFDILGH 1106
gi 13959345 1214 naEIDRL----AAGSTGVKRTTGQHPGGIIVIPNymDVYDFSPVQFpADDVNAewQ---TTHFDFHAIHDNILKLDILGH 1286
gi 6225287   954 kaEMERl----VSMITGVKRTTGQHPGGLMIIPKdkEVYDFTPIQYpANDRNAgvF---TTHFAYETIHDDLVKIDALGH 1026
gi 81854710 1029 kaEIIRI----SRGCTGIKRTTGQHPGGIIVVPKgrEIFEFCPVQHpADDPNSdiI---TTHFDYHSIDQNLLKLDILGH 1101
gi 24418364  987 ksEIKRL----TMGCTGIKRTTGQHPGGVMVVPKdkSIYDFTPIQRpADAEDTdvI---TTHFDYHSLSGKLLKLDILGH 1059
gi 24418366 1034 qaEIERL----TIGCTGIKRTSGQHPGGIMVVPNdnEIYNFCPIQHpADDVNTdiI---TTHFDYHSISGRLLKLDILGH 1106
gi 14424449 1013 dnFVDFL----TEKSTGVKRTTGQHPGGIIIIPKefDVEDFTPVNFpANDTESswK---TTHFDFHAIHDNVLKLDILGH 1085
gi 13959349 1020 dsTVSLy----VQKCIDSKRTTGQHPGGIIIVPKeySIWDFSPYNFpANDINEtwK---TTHFAFEYLHDSLLKFDILGH 1092
gi 81834152 1069 eeESERLagwyASEMSEIKRTTGQHPGGILVFPKdkEIEDFCPVNYpADDKSSkwK---TSHFKFEYLHDTLLKLDILSQ 1145
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3F2B_A       689 DDPTVIRMLQDLSGIDPKTIPtddpDVMGIFSSTEplgvtpeqimcnvgTI----------------GIPEFGTRFVRQM 752
gi 81846181 1107 DNPTILKMLTEQTNVNADTIPnfdnDVMDLFNSTD--------------SLkiknpminkilktgssGIPEFGTNFVKEM 1172
gi 13959345 1287 DDPTMIRKLQSLSGIVPQDIPmddpGVMKLFTGTE--------------SLglteeql--gvklgtlGIPEMGTFTSMNM 1350
gi 6225287  1027 DDPTFIKMLKDLTGIDPMTIPmddpDTLAIFSSVK--------------PLgvdpvel--esdvgtyGIPEFGTEFVRGM 1090
gi 81854710 1102 DDPTVIRMLQDITGINPHEIPmddkETMSLFSSTK--------------ALgvtpeqi--nskvgtfGIPEFGTKFVRGM 1165
gi 24418364 1060 DDPTVIRMLEDLTGVNARKIPlddkKTMSLFTSVE--------------ALgidpeel--gtpvgtlGLPEFGTKFVRQM 1123
gi 24418366 1107 DDPTVLRMLQDLTGLDPKTIPlndpKVISLFTSPD--------------ALgvtkeel--gcevgsyGLPEFGTKFVRQM 1170
gi 14424449 1086 DDPTALKMLEKLTGVNVKDIPkkdeKIISIFTSPK--------------ALgisseeil-gektgalGIPEFGTNFVRQM 1150
gi 13959349 1093 DNPTILKLLKDYTGIDERDVPmydpLVMKSFSDIS--------------ALnikpsdvl-nettgaiSIPEFGTRFVRGM 1157
gi 81834152 1146 EDPTILKYLYEITNVKPEEIPnndpKVLSLFNLDH--------------CLenvnnnpilkdstgalGIPEFGTKITREI 1211
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3F2B_A       753 LEETRPKTFSELVQISGLSHGTDVWLGNAQELIQ--NGTCTLSEVIGCRDDIMVYLIYRGLEPSLAFKIMESVRK-GK-- 827
gi 81846181 1173 LLVTKPQKFSDLIRISGLSHGTNVWNDNAKYLIEe-kGL-TISDVISCRDDIMVYLIDKGITPIIAFKIMEDVRKgK--- 1247
gi 13959345 1351 IAEAKPKNFADLLQISGLSHGTDVWSGNAQDLIRs--GIADLSSVIGCRDDIMVYLIHKGLENGLAFTIMERVRKgMWnk 1428
gi 6225287  1091 LVETRPKSFAELVRISGLSHGTDVWLNNARDWINl--GYAKLSEVISCRDDIMNFLIHKGMEPSLAFKIMENVRKgK--- 1165
gi 81854710 1166 LLDTMPKTFSDLICISGLSHGTDVWLGNAKDLIDq--GIVTLSEAVCTRDDIMIYLIKKGLPPNTAFKIMELVRK-GKal 1242
gi 24418364 1124 LIETRPTTFDELVRISGLSHGTDVWLNNAQDIIRe--GIATLKEVIAARDDIMLYLISKGMDKKLSFKIMENVRK-GK-- 1198
gi 24418366 1171 LVDTQPKSFADLVRISGLSHGTDVWLNNAQYFIKe--GYTTLKDCIATRDDIMVYLMYKDLPPKTAFTIMEKVRK-GK-- 1245
gi 14424449 1151 LSEAKPKTFADLVSISGLSHGTDVWINN-AHYIIqsLGK-TLDQVISCRDDIMVDLIKKGVPIDLSFTIMEQVRK-GKgl 1227
gi 13959349 1158 LVDTKPKSFADLIRISGLSHGESVWLGNAQSLIKsgK---LLKDVIACRDDIMTYLIRQNVEPKTAFLIMEDVRKgKKi- 1233
gi 81834152 1212 LKIAKPASVADLIRVSGLSHGTDVWTNNAADLIVdkHy--KLNEVIACRDDIMTYLSSLGIENQIAFNIMEDVRKgK--- 1286
                        490
                 ....*....|....*..
3F2B_A       828 ---GLTPEFEAEMRKHD 841
gi 81846181 1248 ---GLNEEYQKVLNDNN 1261
gi 13959345 1429 ipaEEREKYVEAMREHD 1445
gi 6225287  1166 ---GITEEMESEMRRLK 1179
gi 81854710 1243 kdpKKWAEYEALMREHE 1259
gi 24418364 1199 ---GVTQEEIEEMKKHG 1212
gi 24418366 1246 ---GLSEEDEALMREKN 1259
gi 14424449 1228 sleQKRKLIEHGienwy 1244
gi 13959349 1234 --kPEHQIILKELKvpe 1248
gi 81834152 1287 ---KLKPEYEKIMQEFN 1300
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap