Conserved Protein Domain Family
CM_1

?
pfam07736: CM_1 
Click on image for an interactive view with Cn3D
Chorismate mutase type I
Chorismate mutase EC:5.4.99.5 catalyzes the conversion of chorismate to prephenate in the pathway of tyrosine and phenylalanine biosynthesis. This enzyme is negatively regulated by tyrosine, tryptophan and phenylalanine.
Statistics
?
PSSM-Id: 311602
View PSSM: pfam07736
Aligned: 170 rows
Threshold Bit Score: 132.553
Threshold Setting Gi: 609234384
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XHO_A        33 WAIRGATTVSDNTADEIVAETQKLLKEXAEKNGLEEDDIISIIFTVTKDLDAAFPAIAARNXGWTSTALXCXNEIDVPGS 112
gi 123499055   2 RGLRGATQCSANTVEAIEDAVTELCRELTSRNQLEPQQIVWAIFTVTHDLDADFPARAARVQGWNGVPMICSQEIPVPGS 81
gi 123723799   2 RAIRGATQVGANAREDIFEATVELVTEMLIRNGLVTDDVISVLFTATSDLDAEFPALAARKAGFHTVPMICASEIGVPGA 81
gi 502685285   4 RAIRGATQLEADEREHLLERTAELVRAVLEANDLGAEELISILFTVTPDLHSEFPAVAGRQIGLTDVPLMCMQEIDVPHA 83
gi 502630352   4 RAIRGATQLEVDDREHLFERTRELVKEVLRANDLDTEALISIVFTCTPDLVSDFPAAAAREMGLGDVPLMCATEIAVPHA 83
gi 151361580  10 RAVRGAVQVDVDEREEVLARTRDLVSEVIRANDLSLDDFISVIFTSTADLVSEFPAVAARELGMGDVPLMCARELEIAGS 89
gi 506278990   4 RGLRGATTLDEDTPEAMRERVQELVSRMLAANGIGKEQLVSILFTATDDLHSLFPATAAREIGLGDVPLICARELDIVGG 83
gi 502917248   4 cAVRGAVQLDRDEREHLLAGVRELLTKVLDANGIGSEDLVSILFTSTSDLVSAFPAEAARELGLLDVPLMCARELDVSGA 83
gi 490067863   4 RAVRGAVQLDRDEAGHMARRVGELLTAVLDRNELVADDLISIWFTATPDLHSDFPAAAARGLGIVDVPLICAQELDVEGA 83
gi 503825709   4 RAVRGAVQLERDEPEHMHEQVSALLTAILGRNALDPDDLISVWFTATPDLHSDFPAAAARKLGITDVPLICAQELDIEGA 83
                         90       100       110
                 ....*....|....*....|....*....|....*
1XHO_A       113 LEKCIRVXXHVNTDKDKkDIKHVYLNGAKVLRPDL 147
gi 123499055  82 MPRVVRVLLHVDSDGPR---NHVYLRGAQALRPDL 113
gi 123723799  82 LPRVVRLMAHVEVDGARpPIRHVYLRGASALRPDL 116
gi 502685285  84 LPRVVRMMVHAESPRSRdKIQHVYLHGAVALRPDL 118
gi 502630352  84 LPRVVRLMAHVNLEVPRrDVQHVYLHGATTLRKDL 118
gi 151361580  90 MPRVIRLMAHVETPRARsEVKHVYLNGAQALRRDI 124
gi 506278990  84 TQRCVRVLMHLEDERPRsAFHHVYLHGAVGLRDDL 118
gi 502917248  84 LPRTVRLMVHARSGLARaDVQHVYLGGAACLREDL 118
gi 490067863  84 MPRVVRILVHVETYLSRaEISHVYLGATAALRKDI 118
gi 503825709  84 MPRVVRILAHVETSLPKsEIAHVYLGAAAALRKDI 118
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap