3WRA


Conserved Protein Domain Family
LigA

?
pfam07746: LigA 
Click on image for an interactive view with Cn3D
Aromatic-ring-opening dioxygenase LigAB, LigA subunit
This is a family of aromatic ring opening dioxygenases which catalyze the ring-opening reaction of protocatechuate and related compounds.
Statistics
?
PSSM-Id: 311611
View PSSM: pfam07746
Aligned: 51 rows
Threshold Bit Score: 81.0774
Threshold Setting Gi: 500997054
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3WRA_B       321 INHFLHRLI-EPDFRKRFVEDPEGLFAESDLTEEEKSLIRNRDWIGMIHYGVIFFMLEKMAAVLGIGNIDVYAAFRGLSV 399
gi 81796291   28 INRFFWHMI-RAPWRDRFLQDAEALMQEADLSEQEKELIRARDWLGLVQYGANFFVIEKFARVVRMTNLQVYAIMRGETF 106
gi 504824772 323 LNQFLYGLI-DPARRAAFLADEEAAYERASLPEEERAMVRARDWRALIRYGVIFFMLEKLGAVVGVSNLHIYAAMRGETL 401
gi 503419207 319 LNRFFWNMK-NPEFRATFSADEAAACRKAGLTPEETRMVAERDWIGLVRYGANFFVLEKFARLVGETNLEVYAEMRGETF 397
gi 500133139  12 syvLLWNMI-RAESRHEYIEDGEKAMTDAGLTDEEKDMIRRLDWIGLVRYGANFFVLEKYARVVKTPNLVVYALMRGQTF 90
gi 503245222 323 LNKFLHQLI-VPEFRTRFRQDEEACFEAAGLSADERDLLRRRDWRGLIHYGVIFFLLEKLGAVCGISNLHIYAAMRGESL 401
gi 835354677   6 MQKFLFQLNrEPEVQRRFAEDRAALLAEYALEPEEYEAMFHGDIGKLYVLGCNGQLLMHFAPLL------------GMPW 73
gi 503853750 321 LNRYLHDMI-HPEHRALFLADPEASFERAGLAEEERDLLRRRDWDGLIRYGCIFFGLEKLGAVVGVSNLHIYAAMRGQSL 399
gi 780075534 321 INDYLHRMV-EPAHREAFKADEEASYEAFGLSEQERDLIRRRDWRGLLHYGVIFFMLEKLGAVTGVSNLHIYAAMRGETL 399
gi 560181462  28 LNRFFWHMI-RAEHRDTYLSDPVAAMTAAGLTPEEQTMVQAQDWLGLVRHGVNFFVLEKFARVVRRTNLEVYALMRGETL 106

                 ....*...
3WRA_B       400 PEFQKTRN 407
gi 81796291  107 EAFMQTRR 114
gi 504824772 402 EAFQRTRN 409
gi 503419207 398 EEFLATRQ 405
gi 500133139  91 EEFMQTRQ 98
gi 503245222 402 ETFQKTRN 409
gi 835354677  74 ADYLQAMR 81
gi 503853750 400 EAFQATRN 407
gi 780075534 400 EAFQKTRN 407
gi 560181462 107 DEFMATRR 114
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap