Conserved Protein Domain Family
S-layer

?
pfam07752: S-layer 
S-layer protein
Archaeal S-layer proteins consist of two copies of this domain.
Statistics
?
PSSM-Id: 311616
View PSSM: pfam07752
Aligned: 52 rows
Threshold Bit Score: 180.858
Threshold Setting Gi: 74533551
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74528761    40 DTNETSPDEFC----WDST-----TFGGLYYSA-NkhkDLVASEDWWgerLQytetdgqyelGKnnpRNHVIGE--DELV 107
gi 121684371   22 RGTILDSGNVSsi-aWDGS-----NWNALYFALnD---VGSNTESLC---YEnidpe-npaiGVt-pDNNIIDK--KELI 85
gi 74533540    42 RGPIINSSNNCgylcWSSS-----NWGPLYCEInN---EASYTESLY---YEniedgsnpplGG---TNCIIDE--GELV 105
gi 74533540   341 RGNTYNTSSGTsl-lWNNS-----LWSAFYFDIkDpetSLKYSENLY---YQniegsehpaiNNtspGSNVIDE--GELV 409
gi 502803405   35 GGNILDSGNVSsi-aWDGT-----NWSALYFGLnE---AGSNTEILY---YQdsdgt-npgiGAa-pTNNVIDK--KELL 98
gi 918021433  559 LDEITGPLDFDri-eINAS-----NFAGFYYDV-D---TGISTESIW---IY----------SEtttSVNIIAP--EGLT 613
gi 502960179  431 VANESEFNDLGti-tWTPKgetgySFAGFWYDL-A---DNRDSEKLM---VDvgh---------lsdTDRQLSDdpSDVR 493
gi 503663439   94 aaqvENNVTNMtl-vADAQ-----NFAGFWYDI-D---DGLSSETLT---LYvnk----------tsGDRTLDDddSDVL 150
gi 890832769  304 DDNNT----------WDAQ-----SFAGFWYDL-D---ANDASENLT---IMne------------tGETTINE--GNLI 347
gi 409169039  791 rgTLAEDENMT----WTPS-----NFEGFKYNIyS---DNIDSERLL---ILadl----------tkEQTIVPA--GSLL 843
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74528761   108 YSTRQ---FPNKYKVvselgldaNTTPSelggmvYYKLPWFGKPYVAV-ENDA-------------TQLANLVIDQpgSD 170
gi 121684371   86 YRTHT---YHKKYKLsak--tdaNAVST------YSVIPLFSKKYIAV-NNDA-------------SKMTTLIKEQggGA 140
gi 74533540   106 YSTAP---YSKAYKAssk--ggsTEVDS------YCLMPWMCKKYVAV-DGDA-------------RKITPIVIEQgsSA 160
gi 74533540   410 YSTTS---YDKTYRVkldhyfevQMVDN------YPVVYWLGNLYVAI-GGDA-------------RKITPVVFEQyyEQ 466
gi 502803405   99 YSSHT---YSKKFKLsak--tdaTEVST------YSVIPWFGNKYVAV-DDKA-------------SKMASLVTEQggGS 153
gi 918021433  614 YTTRI---SPVDYKSr-------NLYGQ------YNIIGFLGEKCVPLgEKTP-------------DKFSRLLLDS--DE 662
gi 502960179  494 YKSTIvsgIESEFDFnn----neSNPWT------YQKIGFLAEEYVPIvEDEA-------------DKLSKLVMDD--DT 548
gi 503663439  151 VYESNvqgVNATFEFn-------GNVYQ------YPKIGFLAEEYVPVeSDGPlveydgqgvfgdvDKLSRLLMDT--DD 215
gi 890832769  348 YNATAvpeQTTEFGFtan--attSADYE------YMKLGFFAEEYFVV-NDDI-------------GTLSKILMDD--DS 403
gi 409169039  844 YETK----MQTSYC---------GDAIQ------FQKLGLFGEEYIPLtDTSP-------------DKLAPLLIND--GN 889
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74528761   171 KKILKAGDVWDLGKNYSLTVNQVDVEGNKVWFSLSKEGEELESGIVDAdgt-ieNQLFTAK-ADFGDGNDQLYFITYVDS 248
gi 121684371  141 EKTLKEGESWDLGNDYSLKLNQLDADAGKAFVILYKDGIELDSDVLDMdgt-ddDRAFIVK-DDLAGIDDLVYFVTYLEN 218
gi 74533540   161 ETILKVGESWDLGKNYSLMCNQVDTDGGKVWLSLYKNGVELESDILDSes--adSRTFVAK-DSFADMDDAVYFVTYADT 237
gi 74533540   467 EKVLKVGESWDLGKNYSLICNQFDEDGGKIWLSLYKGEVELGSEVLNVstndvdDRIFVET-ADFADKKDVIYFVTYVDK 545
gi 502803405  154 EKKLKEGEVWDLGKGYSLELFQLDVEGDKAFVLLYKDGKELDSTVIKLdgt-ddDRSFVVK-DDFADLEDAVYFVTYIDE 231
gi 918021433  663 KLVLRLGQPLELPEGYALEAKQIDVEGDKVWMEFSKDGEFIEDEILDLsn---gTIVWTYEaDDVADEDDVPVMKVAVTG 739
gi 502960179  549 SHTIRTGESLELADGYAITPQQIDVEGDKVWLELTKDGEFVDDKVITVte---gTNTWTYD-QDVMGEDDIVTLKVNIDE 624
gi 503663439  216 SWTLRVGETLDLEDGYAIEPQQIDVEGDKVWLELTKDGEYVDDEIIDVsd--snDTTWFYD-QTVLDEDDVVTLAISVDQ 292
gi 890832769  404 SYTMRTGETLELEEGYAITPQQIDVDGNKVWLELTKDGEFVDDKVINTdssnqsQKTWYYE-QDVEDQEDVVTLMVHIDE 482
gi 409169039  890 TYIMESNQSLILANGYFLLPYKIDIEGSKVWLKLYQDGEFIDDEIIDT------SGTWTYLlDGILGEDDVEVLKIHVGS 963
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 74528761   249 VFMSATDSFAVFKYTWLIDkNDILIIKEGDEYQGFEVKEASESELVLKNSDSITLNLDKDVknYFTDSWYFQTSD 323
gi 121684371  219 TFKSTSESFAILKYTWLIDkDNVITIKKGDKFGLLKCKDVSENWINMSNDVVITLEMDNTV--YFTDDWYFQTSk 291
gi 74533540   238 VFSSATDNFVRLKYTWLIDkDDVTIIKVDDKFGEMECTEASENLIKLSNANRMELKIDGDT--FFTDDMYIKTSa 310
gi 74533540   546 AFKSESDTFVKLMATLLLDkDTVLTIETEDKFGEMKCIEASENSIKLANEDSITLELDGDT--YFTDDMYFTTSk 618
gi 502803405  232 TFRCSSECFAIFKYTWLIDkDNVSTIEEGDKVGLLKCREISENWINMSNHEEITLEMNEKA--YFTDDWYIRTSk 304
gi 918021433  740 LLQDQAVGWVMIDGLWLTDvGNIIQVHSQSQFGKMEVVCIGYNELYLANPRSITLKRGSSI--EIMDNFSIRIAa 812
gi 502960179  625 VFQGQVDSLAVIEGVWQIA-DDGIELESEDSYGNMEIDTVDGNTIDMILSSSITLSDDSEQ--HLMEDIYFKVAD 696
gi 503663439  293 VFQGTVDSLVVIEGVWQIA-DDGLEIETDDTFGNMAIESTSDAQIIMELDSSITLRHDTTR--NVMEDLKFRMAD 364
gi 890832769  483 VFQGQVDSLCILEGVFQIS-DTAMVIEEEDEFGELEVISLTDNTIRMENADDLDVPDDEVL--DITDELKVKgnd 554
gi 409169039  964 I--SSVTDSISIKGVWMIDwENTFEIMPDDEFGILKVEPISNNMLLFTSIQDIDL-RDNTGskQIAGDLYFQVTN 1035
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap