Conserved Protein Domain Family
FEZ

?
pfam07763: FEZ 
FEZ-like protein
This is a family of eukaryotic proteins thought to be involved in axonal outgrowth and fasciculation. The N-terminal regions of these sequences are less conserved than the C-terminal regions, and are highly acidic. The C. elegans homolog, UNC-76, may play structural and signalling roles in the control of axonal extension and adhesion (particularly in the presence of adjacent neuronal cells) and these roles have also been postulated for other FEZ family proteins. Certain homologs have been definitively found to interact with the N-terminal variable region (V1) of PKC-zeta, and this interaction causes cytoplasmic translocation of the FEZ family protein in mammalian neuronal cells. The C-terminal region probably participates in the association with the regulatory domain of PKC-zeta. The members of this family are predicted to form coiled-coil structures, which may interact with members of the RhoA family of signalling proteins, but are not thought to contain other characteristic protein motifs. Certain members of this family are expressed almost exclusively in the brain, whereas others (such as FEZ2) are expressed in other tissues, and are thought to perform similar but unknown functions in these tissues.
Statistics
?
PSSM-Id: 311622
View PSSM: pfam07763
Aligned: 27 rows
Threshold Bit Score: 223.343
Threshold Setting Gi: 1020966579
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122063519   61 NFDEKIAACLkDHEVTTADIAPVQIRTQEEVMNESQTWWTLTGNFGNIQPLDFGTSSICKKMAAALDsd--------sLK 132
gi 74803949    21 TFDEKITKCFgNYEQSVEELAPVQVRSQEEIMNECQMWWTITGNFGNILPIDWSKTYARQMHVPALN-----------LG 89
gi 393912527   64 TFDQKISHCFkDLNKTTEEIAPIQVRSQDEIMSESQIWWTLTGNFGNMPPLDFSKTQTRQLQLPALN-----------LQ 132
gi 260831344   60 EFDETLNICFrNYNAKTDSIAPVKVLSQEEIMENSELWQGLTDNFANVLPVDWNSSYTRQLYNKALN-----------LN 128
gi 1005958519  89 TFDEKITKCFhDYEESVEKLAPVQVRAQEDIINDSQMWWTLTGNFGNILPVDWSQSYARKLQLPSLKakdqngtnincLN 168
gi 328709446  125 TFDDKITRCFcDYEESVEKLAPVQIRTQEEIMNECQMWWTITGNFGNILPIDWSKSYARKVQLPVLN-----------LN 193
gi 195347821  143 TFDEKITKCFgNYEENVEELAPVQVRSQEEIMNECQMWWTITGNFGNILPIDWSKSYTRQMHMPTLN-----------LG 211
gi 156548791   84 TFDEKITTCFrDYGTNVESLAPVQVRSQEEIMNECQMWWTITGTFGNILPIDWSKSYARKLHVPTLN-----------LN 152
gi 48103592    85 TFDEKITSCFrDYGTNVESLAPVQVRTQEEIMNECQMWWTITGTFGNILPIDWSKSYARKMHMPALN-----------LN 153
gi 242012918  125 TFDERITKCFcDYEENVEKLAPVQVRTQEEIMNECQMWWTITGNFGNILPIDWSKSYARKLHVPTLN-----------LT 193
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122063519  133 DD-----------------------------------ASTRRSMT-----NSDDEDlLRQQMDVHQMIghHHGSTDtg-g 171
gi 74803949    90 MR-----------------------------------KPGTPDDEllqdlSSEDEA-VASDLDMHALI--LGGLHAd--- 128
gi 393912527  133 PRk----------------------------------ENSDAGID-----LSEDEE-LRSALDMHQLIsqRGPLSE---- 168
gi 260831344  129 EQk---------------------------------vREEPMNLD-----LSDDEE-LRESFDAHSLI--ISSLTQ---- 163
gi 1005958519 169 SK-----------------------------------NSLNHGDNilgdtTLDEED-LAKDLDLHSLI--LSSLHQ---- 206
gi 328709446  194 NN-----------------------------------IQDESSDDl----SSEDEA-VSNDLDLHTLI--LSGPSAd--- 228
gi 195347821  212 QNhtkqqqqnrnqqqqlhtqshqayphtngagsgsglDAQTPGDEfn-dlTSEDEA-VANDLDMHALI--LNGLNGdm-d 286
gi 156548791  153 E------------------------------------SAKSFDGNgledlSSEDEA-VATDLDMHALI--LSSRNDnynv 193
gi 48103592   154 E------------------------------------APVSQERPeledlSSEDEA-VATDLDMHALI--LSSSTDthsp 194
gi 242012918  194 EN-----------------------------------NGGNSNDDii-nlSDEDEQ-VANDLDMHSLI--LNGLRQd--- 231
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122063519  172 eTPPQTADQVIEEIDEMLQSCDFTGsmm-tdrTMESVDSMYs-----SmrspfpsSIQSSDADIKLrSAQALVSNPDNLQ 245
gi 74803949   129 nEPIKTADEVIKEIDDIMDETGS---------EDGQLEN---------------------EVIEKAkEVLGSPLYEEKLR 178
gi 393912527  169 -SPPQTADQVIEEIDQMLQSCDFSGsvm-tdrTMESMDSMYssmrspL-------PNGQYDIDIKLrQAIVITSNSENLE 239
gi 260831344  164 -EPIFTAEEVIEEIDEIMGETSM---------EEETPVSEDs-----L-------SVLSQEMLALReRSNTVTSYDESLK 221
gi 1005958519 207 -EPIFTAEQVLEEIDKIMQETSPTDkdssepmEEEKESS-------------------TNRTVNETdNGIRSLIYREKLE 266
gi 328709446  229 iEP-PTADEVIREIDDIMEEGTS---------NECTPDS-------------------------EHpKEVHSPLLEEKLK 273
gi 195347821  287 dQPIKTVEEVIKEIDDIMDEAESPLd------EPETCDS---------------------EVIEKArEVLGAPLYAEKLQ 339
gi 156548791  194 eEPVKTADEVLKEIDDIMQESPS---------SDVSMNSDS---------------LGANEALERSkEVLSSPLHEKNLQ 249
gi 48103592   195 eEPLKTAEEVLREIDDIMQESPS---------MERSPDSDGs-----L--------LDSDEALERSrEVLGSPLHEKKLK 252
gi 242012918  232 cESVKTAEEVIREIDDMIQEDFTGD-------SEESPDC---------------------QDYERPkQIVHSPLYEEKLK 283
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 122063519  246 ELSYSKLVTLCAEMEQLIRVYNESLVDELAHRDELDYEKEMKNSFISLLLAIQNKRRVYANDRKRKVGKAS 316
gi 74803949   179 SLSITQLNELYMEMEVLIREFSETLISELALRDELEYEKELKNTFISLLLAVQNRRRQYHVEKKKGKAGGK 249
gi 393912527  240 SFSYSRLLALSAEMEQLIQVYNDSLVEQLAHRDELEYEKEMKNTFISLLLSIQNRRRHFTNERKRKPLKTd 310
gi 260831344  222 KLPLQTLNEVLEELEATIKEYSEILIQQLALRDELVYEKEVKNQFISALVAVQNRQREHkqnkdnkkkrkk 292
gi 1005958519 267 KLTITQLNELYIELERMIQGNSETLIQELALRDELEFEKELKNTFISLLLGIQNKRRKHHLERKKGKSANe 337
gi 328709446  274 TLNVSQLNEVYMELELLIRDYSETLITELALRDELEFEKELKNSFISLLLAVQNRRRQYHVEKKRNSRAGN 344
gi 195347821  340 YLTTTQLNELYMEMEVLIQELSETLINELALRDELEFEKELKNSFISLLLAVQNKRRQYHVEKKRGKFQGP 410
gi 156548791  250 QYSLKQLSDLLAEMDSLISALSETLISELALRDELEYEKELKNQFISLLLAVQNRRRQHHVAKKRNQLQNG 320
gi 48103592   253 HLTSSQLNELLGEMESLVGALSETLIAELALRDELEYEKELKNQFISLLLAVQNRRRQHHVTKKRNQMQNG 323
gi 242012918  284 QLSLSQLNEVYLEVEVLIQKYSETLISELALRDELEYEKELKNTFIDLLVSVQNRRRQYHAERKRCNRNGN 354
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap