Conserved Protein Domain Family
LETM1

?
pfam07766: LETM1 
LETM1-like protein
Members of this family are inner mitochondrial membrane proteins which play a role in potassium and hydrogen ion exchange. Deletion of LETM1 is thought to be involved in the development of Wolf-Hirschhorn syndrome in humans.
Statistics
?
PSSM-Id: 311625
View PSSM: pfam07766
Aligned: 146 rows
Threshold Bit Score: 171.898
Threshold Setting Gi: 761907794
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13124700    181 LRTRIWDELVHYYHGFRLLFIDVAICSKLLW-----RV-LN--G--K---T---LTRRENKQLQRTTSDLFRLIPFSVF- 243
gi 321457958    66 RFPRAMKVYRVFSVGIKDLYQDTKTFVKAKSlirnaKK-NG--GgiH---S---LGLKEIDIFYRMPREMLKVSPVLLI- 135
gi 156543736    73 NFPKTMHVYRVFSIGSKEFYADLKRYMQVRK-----KI-RN--F--Ga-dT---LNREELQLTFTFPKDLIKISPVLLI- 137
gi 241648042    68 KFPVAYRLHQVFLIGTRDLYQDIREYMRISQ-----EL-RY--G--KsvrE---LSRKELELYFQIPRDIIKVAPVLFV- 133
gi 749745472    69 KFPRTMQVYRVFSVGSRDVYADLKRFVSAIK-----KQgSN--G--Id--S---LTRKELQLMHMMPRDLRKLTPLFLL- 133
gi 1005952422   54 RFPKAFEVYQVFTVGTRALYTDTVEYLRISR-----EL-SY--G--KdvrS---LSYQELLVYYQTPKDLLKVAPTLLV- 119
gi 242023008    21 MFPTAVKIYQDFSVGLKFLKSDFITLFRAFK-----KI-TSc-Gl-N---S---LTRKELEVYYELPKDILRTAPVIFIg 86
gi 241896972   120 WSPSTAKYARLSVFGCKYLYKDVLVLLSAYK-----KY-YS--SdlS---S---LTYAELELKYRLPLQLVRLTPILIF- 184
gi 459179330    99 vSPSAKKIMDNLVAGFRHEWANIQSYWKISK-----RK-YNhpG--S---Y---ISYREEMTIYNLNQDGIKAAPLLPI- 163
gi 195588809   148 NFPKAMQLYRVFFDGVKDFFGDMKRFLKIAR-----IA-NDs-P--Q---GiraLNRQELELYMQMPRDMMKVAPALIG- 214
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13124700    244 IIVPFMELLLPLFIKFFPG-M-LPSTFQTSTDRQEK----L----RQ----SLSVRLEVAKFLQQTLDQMpvqHKEHS-S 308
gi 321457958   136 SALPFANYIIFPLAYVLPKqL-LSTHFWSLQQRRDFalqdH----KK----SVQHFRPTFRCMQARI-------PSVNdT 199
gi 156543736   138 SAVPFTNYIIFPLAFYFPHvL-LTSHYWSIEDKLNF----MlkehKK----RLQHNKPLLRCVQSQVKTI-------QdT 201
gi 241648042   134 IALPATNFFMFPLIYLFPKqL-LTWHFWSLEQRVDFsvatQ----RK----KVSNYLPVLRYMQANVPk----------G 194
gi 749745472   134 SAIPFTNYIIFPLVLYFPRyL-LTSHFWTLQQKLEF----MlhdhKR----RLRHNRPLFRCMQAELKTI---Gd----Q 197
gi 1005952422  120 SAAPFANYVVFPLALYFPKqL-LSQHFWSKEIRFNY----QlektKK----RLKHNRPIFRYLQFKLSSI---PKQLSnS 187
gi 242023008    87 AVVPFGG-IIFILGYYFPKhL-LTHHFWSQQQQNEFsslkH----KK----TISSYTPVYNCLESRLSVI-------KdT 149
gi 241896972   185 WPVPFTNLFLFPLAFMFPKyL-LSEHFWTDEQLKEY----W----IKdqqnNFEHNMRVFEHLSLMAEE--------CsD 247
gi 459179330   164 AVLPMGFFLILIPVYFFPR-LvLPQTFWSKHQRYKF----LsqihRS----RILDYGVIIHHLNYH--------KLNSdQ 226
gi 195588809   215 CSLPMVGYAFFPLVFYYPRsF-LTAHFWTPQQRSEF----QsyymKR----RLCNNKDVFRCLQAKL--------KATaS 277
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13124700    309 E-E---AKQFEAFFTKIRNPTEPVSNDEIIK----FAKRF-DD-E-ITLDSLSREQLAALCRVLELNTIGTTTLLRFQLR 377
gi 321457958   200 D-L---TKKLSQILSKLASGVH-PTVEEILE----VKMLF-QR-EpFHLNCLYPRHKNQLLKVHGMH---TLWSRRRRLS 265
gi 156543736   202 E-S---RATFKNIIACLGSGTH-PTIDDILY----CKKLF-SG-PpYSLKCMKRKHVKELLKVHGMSRFSLGN--RTRLL 268
gi 241648042   195 E-E---GQKLLRIFHKLGSGTH-PTVEDILD----AKQYFiAK-P-LALSKLSRKHLSSLCRIHGKSTFFLG--RRSRLW 261
gi 749745472   198 T-L---RIKWRDVIACLGSGTH-PTTNDIIA----CSVLF-SG-PpYSLDVLKRKHMKELLAIYGMSSW--RLFKRKRLM 264
gi 1005952422  188 P-DidfKEQCKLIYDKLGSGTH-PTVEELLK----VSPVFdQQ-P-YGLLHLSKSHLSHLCKMHGITSLP---RKVPRLV 256
gi 242023008   150 D-L---CLKMCNLLENIKSNVH-PNAKSILS----VKSLF-KGvP-FGLNHMESYHISKLLNLYNMHK---GWRRRERLY 215
gi 241896972   248 D-M---LLKWFRVIECLGAGGVSP-VDDIIQ----AIPVF-TMfP-YHFSTLPRQHIKVLLKMYNIHR---GWRRRVRLK 313
gi 459179330   227 N-T---KYALEGICNSL-AGGNIPSNSDMLNnlkpLCKLH-DG-P-CNVDHMVYVLLRAFCRTIMVSTYQPPSWLKYRLR 298
gi 195588809   278 HpK---HSAFAEILGQLGSGTh-pTPEMLID----VKDIF-AD-GpYSLLGMSRKHVRNLVNLHGLPS---SIFKRHRLH 344
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13124700    378 LKLRSLATDDRVIARE-G-VDSLDLLELQQACKARGMRAYGLTEERLRFQLKEWIDLSLNEQVPPTLLLL 445
gi 321457958   266 QRAEEIINKDKVLERE-G-VTSLSLEELRSACYTRGLNPSNMRTEDMVKYLEQWIAVSVHVDPATYSLVL 333
gi 156543736   269 ERGLLIKRMDTAIQRE-GgVTKLPYDAIRWALSFRGVNPVNMSTESMQAWLDQWLLISSQVDEGSISLLL 337
gi 241648042   262 RHGGFVHEMDLAMARE-G-IDQMDVAELRWACFLRGLNPMGLSKKDLIAWLQDWikisssidsqsmslll 329
gi 749745472   265 ERGMLILRMDRAIVRE-GgVKAMSNDAMRWALSFRGVNPTNMSTESMRSWLEQWLTVSASVDQKNISLLL 333
gi 1005952422  257 NYCGLVHELDLAILRLgG-SAKLSDNDLKLAANMRGLNPFGCSREELTNWLDNWLYISKALNGTCPSLLL 325
gi 242023008   216 MRANLVKLMDLAIIKE-GgPEILNLHDMRWHCFFRGLNPINMNNDELLFWLRMWLEISREIDKNSYSLLL 284
gi 241896972   314 KLAQYIQLMDRAIESE-GgPDKLNDRQLKWACLFRGLSPFSSSRETLVLYLKDWIKISSKIDNDSLSCIL 382
gi 459179330   299 KNASLVISLDHKLRRE-GlLNNLSSLELSTASMMRGIDGAELSREAQLYWLNNWLQITKTCDDDDAWFVL 367
gi 195588809   345 EHAFLVHYMDQAITREgG-VHNLTPDALRYSCYLRGLNPDSLSSEAMIEWLRKWVKVSTSIQGEHITLFL 413
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap