Conserved Protein Domain Family
LETM1

?
pfam07766: LETM1 
LETM1-like protein
Members of this family are inner mitochondrial membrane proteins which play a role in potassium and hydrogen ion exchange. Deletion of LETM1 is thought to be involved in the development of Wolf-Hirschhorn syndrome in humans.
Statistics
?
PSSM-Id: 336805
View PSSM: pfam07766
Aligned: 147 rows
Threshold Bit Score: 161.113
Threshold Setting Gi: 761907794
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13124700    181 LRTRIWDELVHYYHGFRLLFIDVAICSKLLW-----RV-LN-G--K---T---L-------------TRRENKQLQRTTS 232
gi 321457958    66 RFPRAMKVYRVFSVGIKDLYQDTKTFVKAKSlirnaKK-NG-GgiH---S---L-------------GLKEIDIFYRMPR 124
gi 156543736    73 NFPKTMHVYRVFSIGSKEFYADLKRYMQVRK-----KI-RN-F--Ga-dT---L-------------NREELQLTFTFPK 126
gi 241648042    68 KFPVAYRLHQVFLIGTRDLYQDIREYMRISQ-----EL-RY-G--KsvrE---L-------------SRKELELYFQIPR 122
gi 749745472    69 KFPRTMQVYRVFSVGSRDVYADLKRFVSAIK-----KQgSN-G--Id--S---L-------------TRKELQLMHMMPR 122
gi 1005952422   54 RFPKAFEVYQVFTVGTRALYTDTVEYLRISR-----EL-SY-G--KdvrS---L-------------SYQELLVYYQTPK 108
gi 242023008    21 MFPTAVKIYQDFSVGLKFLKSDFITLFRAFK-----KI-TScGl-N---S---L-------------TRKELEVYYELPK 74
gi 241896972   120 WSPSTAKYARLSVFGCKYLYKDVLVLLSAYK-----KY-YS-SdlS---S---L-------------TYAELELKYRLPL 173
gi 761907794    61 RWKYIVTVVKSFVQGMKLLIKDVKEARRLRR---------N-G--L---K---LdgtrprpppestiTWEDLRFIDKTVS 122
gi 195588809   148 NFPKAMQLYRVFFDGVKDFFGDMKRFLKIAR-----IA-NDsP--Q---GiraL-------------NRQELELYMQMPR 203
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13124700    233 DLFRLIPFSVF-IIVPFMELLLPLFIKFFPG-MLPSTFQTSTDRQEK----L----RQ----SLSVRLEVAKFLQQTLDQ 298
gi 321457958   125 EMLKVSPVLLI-SALPFANYIIFPLAYVLPKqLLSTHFWSLQQRRDFalqdH----KK----SVQHFRPTFRCMQARI-- 193
gi 156543736   127 DLIKISPVLLI-SAVPFTNYIIFPLAFYFPHvLLTSHYWSIEDKLNF----MlkehKK----RLQHNKPLLRCVQSQVKT 197
gi 241648042   123 DIIKVAPVLFV-IALPATNFFMFPLIYLFPKqLLTWHFWSLEQRVDFsvatQ----RK----KVSNYLPVLRYMQANVPk 193
gi 749745472   123 DLRKLTPLFLL-SAIPFTNYIIFPLVLYFPRyLLTSHFWTLQQKLEF----MlhdhKR----RLRHNRPLFRCMQAELKT 193
gi 1005952422  109 DLLKVAPTLLV-SAAPFANYVVFPLALYFPKqLLSQHFWSKEIRFNY----QlektKK----RLKHNRPIFRYLQFKLSS 179
gi 242023008    75 DILRTAPVIFIgAVVPFGG-IIFILGYYFPKhLLTHHFWSQQQQNEFsslkH----KK----TISSYTPVYNCL-----E 140
gi 241896972   174 QLVRLTPILIF-WPVPFTNLFLFPLAFMFPKyLLSEHFWTDEQLKEY----W----IKdqqnNFEHNMRVFEHLSLMAEE 244
gi 761907794   123 DLKRVFPTIAL-FWIPLVGYVAPFLALAFPKyLLSSHFWSADQRKEF----E----EKnkvmRKDNTKRLKEYLLE---- 189
gi 195588809   204 DMMKVAPALIG-CSLPMVGYAFFPLVFYYPRsFLTAHFWTPQQRSEF----QsyymKR----RLCNNKDVFRCLQAKL-- 272
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13124700    299 Mp-VqHKEHS-SE-EAKQFEAFFTKIRNPTEPVSNDEIIKFAKRF-DD-E-I---TLDSLSREQLAALCRVLELNTIGT- 368
gi 321457958   194 ------PSVNdTD-LTKKLSQILSKLASGVH-PTVEEILEVKMLF-QR-EpF---HLNCLYPRHKNQLLKVHGMH---T- 256
gi 156543736   198 I--Qd------TE-SRATFKNIIACLGSGTH-PTIDDILYCKKLF-SG-PpY---SLKCMKRKHVKELLKVHGMSRFSL- 261
gi 241648042   194 -----------GE-EGQKLLRIFHKLGSGTH-PTVEDILDAKQYFiAK-P-L---ALSKLSRKHLSSLCRIHGKSTFFL- 254
gi 749745472   194 I--Gd------QT-LRIKWRDVIACLGSGTH-PTTNDIIACSVLF-SGpP-Y---SLDVLKRKHMKELLAIYGMSSW--- 255
gi 1005952422  180 IpkQ-LSNSPdID-FKEQCKLIYDKLGSGTH-PTVEELLKVSPVFdQQ-P-Y---GLLHLSKSHLSHLCKMHGITSLP-- 249
gi 242023008   141 S--R-LSVIKdTD-LCLKMCNLLENIKSNVH-PNAKSILSVKSLF-KGvP-F---GLNHMESYHISKLLNLYNMHK---- 206
gi 241896972   245 ---------CsDD-MLLKWFRVIECLGAGGVSP-VDDIIQAIPVF-TMfP-Y---HFSTLPRQHIKVLLKMYNIHR---- 304
gi 761907794   190 --------NKnDG-PVKIIADCLDKVKQQKE----KDISDWNWVS-ES-G-ImsmDLSSLSSQHINCLSHSWGIKTLLPf 253
gi 195588809   273 -------KATaSHpKHSAFAEILGQLGSGTh-pTPEMLIDVKDIF-AD-GpY---SLLGMSRKHVRNLVNLHGLPS---- 335
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 13124700    369 TTLLRFQLRLKLRSLATDDRVIARE-G-VDSLDLLELQQACKARGMRAYGLTEERLRFQLKEWIDLSLNEQVPPTLLLL 445
gi 321457958   257 LWSRRRRLSQRAEEIINKDKVLERE-G-VTSLSLEELRSACYTRGLNPSNMRTEDMVKYLEQWIAVSVHVDPATYSLVL 333
gi 156543736   262 GN--RTRLLERGLLIKRMDTAIQRE-GgVTKLPYDAIRWALSFRGVNPVNMSTESMQAWLDQWLLISSQVDEGSISLLL 337
gi 241648042   255 G--RRSRLWRHGGFVHEMDLAMARE-G-IDQMDVAELRWACFLRGLNPMGLSKKDLIAWLQDWikisssidsqsmslll 329
gi 749745472   256 RLFKRKRLMERGMLILRMDRAIVREgG-VKAMSNDAMRWALSFRGVNPTNMSTESMRSWLEQWLTVSASVDQKNISLLL 333
gi 1005952422  250 --RKVPRLVNYCGLVHELDLAILRLgG-SAKLSDNDLKLAANMRGLNPFGCSREELTNWLDNWLYISKALNGTCPSLLL 325
gi 242023008   207 GWRRRERLYMRANLVKLMDLAIIKE-GgPEILNLHDMRWHCFFRGLNPINMNNDELLFWLRMWLEISREIDKNSYSLLL 284
gi 241896972   305 GWRRRVRLKKLAQYIQLMDRAIESE-GgPDKLNDRQLKWACLFRGLSPFSSSRETLVLYLKDWIKISSKIDNDSLSCIL 382
gi 761907794   254 PFWQRRRLVKRLNYIYGCDYLLQSR-G-INDRGRK--REALMERGVSVKNVDRA-----LDVWLSLSNSQENCPYVLLs 323
gi 195588809   336 SIFKRHRLHEHAFLVHYMDQAITREgG-VHNLTPDALRYSCYLRGLNPDSLSSEAMIEWLRKWVKVSTSIQGEHITLFL 413
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap