Conserved Protein Domain Family
PsiF_repeat

?
pfam07769: PsiF_repeat 
psiF repeat
This region is approximately 35 residues long. It is found repeated in a number of putative phosphate starvation- inducible proteins expressed by various bacterial species. psiF is known to be an example of such phosphate starvation-inducible proteins.
Statistics
?
PSSM-Id: 311627
View PSSM: pfam07769
Aligned: 72 rows
Threshold Bit Score: 29.9262
Threshold Setting Gi: 0
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30
                  ....*....|....*....|....*....|...
gi 122326947   71 GMNPQERMKSCNAKASEKKLDSKLRTAFMSGCL 103
35_pfamImport   1 LTAQQEKMRMCNQQAKGK--KGEERKAFMRSCL 31
11_pfamImport   1 QAAQQKRMTDCNQQASGKALKGADRSTFMSTCL 33
55_pfamImport   1 QAAQQKKMTDCNQQASTQSLKGDERKKFMSQCL 33
9_pfamImport    1 PTPQQQRMTDCNQQASAKMLKGEERKTFMSQCL 33
41_pfamImport   1 LTAQQQRMATCAKESTGK--KGAEHRAFMSSCL 31
46_pfamImport   1 HTAQQQRMIDCNKQATGK--KGAERKAFMSSCL 31
10_pfamImport   1 LTPQQQKMSDCSKAATAKSLKGDERSTFMSSCL 33
44_pfamImport   1 LTEQQQRMQSCSQQAGAKTLKGDERKSFMSSCL 33
27_pfamImport   1 KTAQQQKMTVCNQQAGEKTLKGDERKTFMSNCL 33
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap