Conserved Protein Domain Family
CENP-I

?
pfam07778: CENP-I 
Mis6
Mis6 is an essential centromere connector protein acting during G1-S phase of the cell cycle. Mis6 is thought to be required for recruiting CENP-A, the centromere- specific histone H3 variant, an important event for centromere function and chromosome segregation during mitosis.
Statistics
?
PSSM-Id: 311633
View PSSM: pfam07778
Aligned: 5 rows
Threshold Bit Score: 898.861
Threshold Setting Gi: 1020980048
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82101443     9 HSKRPLQVHHSNQTDLSAWRKGGTVDTEKSA----------QNRQSLSDQKNDNEQDSLEQALSYFEKIQDRVSLKKSEV 78
gi 620979987   13 KRKRVSRGRRSTQTDLAAWRLGERTSGSKPVnlktgqkqreEDFTSDDDQAQDGERDSLRKALRYFEKGQISVPLRKNPT 92
gi 1020980048   9 TPKQ--HVRSKSQTDLSAWRKGGRIDSEKSL----------QN-QSANDQKYDSQEGSLKQALSYLEKVQGRVALKKNSV 75
gi 731513053   11 AQRRTSQGRLSDQ-------IKEKPSYSESIlkhgq-nnpeEDSEHA---------EVLQIALRYFEKGPIKTLQSKGKT 73
gi 564399935   12 QQNRISQGSNSRQTTLLDWKVKDKAGNSKSVlees---sslEDSNHADDQT----EDALQTAVEYFQKGPKKASLSKDSV 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82101443    79 LQKHLSTMESIALKRGLPPEGFDVLLDVALSGKLADTVNTRLLKSLIPASAIPESSIVSSVSWFCVSKCSSNIQLLFLRW 158
gi 620979987   93 LQKHLETVENVAWRTGLPPESIDTLLNVALSGRFAEAVNTRLLKCMIPTTLILETSIVAAVSWLCVGKCSGSNKILFFRW 172
gi 1020980048  76 LQKHLNAVESTALTQGLPPEGFEILLNVVLSGKFADTVNTCLLKCLIPASVIPENSVVKAVSWLCVRKCSANIQLLFLKW 155
gi 731513053   74 MEEHLKTVENVAWKNGLAPEKIDILLNVALSGKFGNSINTRILKCLIPATVISGDSVVKAVSWLCVGKCSGSTKVLFFRW 153
gi 564399935   85 LEKHLKTVENVAWNNGLAPEAIDILLNVALSGKFGNALSTRILKCMIPETHISEDSVVKAVSWLCVGKCSGNTKVLFYRW 164
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82101443   159 LITMFDFIDHKEQVHALYGIFFSFLNDEKLCPYICHVLYLLTRKENVKPFRVRRLLDLQSKMGMQPHLQALLSLYKLFCP 238
gi 620979987  173 LIAMFDFVDHKEQINSLYGFIFAFLQDENLCPYICHLLYLLTRRENVKPFRVRKLLDLQAKMGMQPHLQALLSLYKFFCP 252
gi 1020980048 156 LITMFDFIDHKEQLRALYGFFFFFLQDDKMCPFVCHVLYLLTRKENVKAFRIRALLDLQAKMGMQSHLQALLSLYKLYCP 235
gi 731513053  154 LVAMFDFVNEKDQVNSLYGFFFASLQDDALCPYVCHLLYLLTKKENVKPFRVRKLLDLQTKMGMQSHLQALLSLYKFFAP 233
gi 564399935  165 LVAMFDFIDHKKQINSLYGFFFVSLQDDTLCPYVCHLLYLLTKKENVKPFRARKLLDLQAKMGMQPHLQALLSLYKFFAP 244
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82101443   239 ELVSITLPQKMKTYFKNADGPWKAAINAVRQRNQANSTVPQPLLLGTAQPHSRKRKWNTQLIVPASSANAQNLVVGGK-M 317
gi 620979987  253 ELVSISLSTNRKTYFKDSECLWKTALSAVRQRNQGPSPGSPKLILGTTSIQSRRRKWNTSLVVPLCSSQDSNPQSGNReL 332
gi 1020980048 236 EQVTITLPGKMKTYFKNPEGPWKAAIAAVRQRNQGTSALSQRMFLGTSQPQSRKRKWNAQLVIPASSTNNLGE---DRqK 312
gi 731513053  234 TLISVSLPVRKKIYFKNSENLWQMALIAVRQRNMGPSPVSLKLILGSAKVRPVNRKRNSYSVIPLPNSSNYVRECGKKeM 313
gi 564399935  245 TLISVSLPVRKKIFFNNSKNLWTPALLAVKLRNQGIFPEPLKLQLGPTSGRSLKRKWNYHSVIPAVNSAK--KECREK-M 321
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82101443   318 SRADSYSANESFPVEQLRTFPQLLQNIHRLEFPSQMGSVLTNPLLLHYMNCSKDESVYLRLYYWMGQTLQEECTWCVVDN 397
gi 620979987  333 KLVHFLKTDESFPPEQLHTFSQLLQNAHCLELPSQMGSVLKNSLLLHYLNCIKDESVLLRLHYWINNTLKEDCIWHPTGD 412
gi 1020980048 313 NSVCLYSTNETFPVEQLQTFPQLLQNIHRLEFPSRMGSVLTNPLLLHYMNCVKDESIYLRLYYWMGQMLQEECTWCVVDN 392
gi 731513053  314 SISDCLSNNGSFPVEQLQSFHQLLENIHCLELPCQMGSVLNSSLLLHYINCVRNESVLLRFYHWLSLTLQEECVWYKVNN 393
gi 564399935  322 SLFDYLSNDRSLPVEQLQSFPQLLENIHCLELPSQMSSVLNSSLLLHYVNCVKDESILLRLSYWLSQTLQEECVWYNMND 401
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82101443   398 NQYEEEFRGFLETVYKAECFLQEGFPSCEEFLYRSLPLWDGVSCRSQILQLVSWIPLSTFSEMKSQLCDPLAQLFFTSSL 477
gi 620979987  413 HLDNEEFKEFLNLIFRTECFLQEGFSSCEKFLYKSLPSWDGFGFRSQILPLVTWIPLRNFSEIKALLCEPLAQLFFTSSI 492
gi 1020980048 393 SS-EEEFKSFLETIYKSECFLQEGFSACEEFLYKTLPLWDGLCCRSEVLSLLSWISLSSFSDIKSYIYDPLAQLFFTSSI 471
gi 731513053  394 SEFGKEFTSLLDSIIRAQCFLQEGFYACEAFLYKSLPFWDGLCCRSQFLQLVSWIPFSNFCELKPLLFDHLAHLFFTSTI 473
gi 564399935  402 YQQEKEFINFLDMVIRVQCFLQEGFYSCEAFLYKSLPLWDGFSCRSQFLKLLAWIPFSSFSEIKPLLLDHLAPLFFTSSI 481
                         490       500       510
                  ....*....|....*....|....*....|....
gi 82101443   478 YFKCSVLESLKELLQNWLNWHVVQLDSES--DSQ 509
gi 620979987  493 YFKCSILQTLRELLQNWLLSHATDMDEEPiiNSP 526
gi 1020980048 472 YFKCSVIESLKELLQNWLNESQMHLEL-----SS 500
gi 731513053  474 YFKCSVLQSLKELLQNWLLCLSTDIHMKPvlNSP 507
gi 564399935  482 YFKCSLLQCLKDLLQNWLLWLSTEAQVQPmtDSP 515
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap