Conserved Protein Domain Family
Spb1_C

?
pfam07780: Spb1_C 
Spb1 C-terminal domain
This presumed domain is found at the C-terminus of a family of FtsJ-like methyltransferases. Members of this family are involved in 60S ribosomal biogenesis.
Statistics
?
PSSM-Id: 311635
View PSSM: pfam07780
Aligned: 112 rows
Threshold Bit Score: 155.094
Threshold Setting Gi: 124452196
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121788993 501 DDE-------WEgvsasek---eesdddDELLEEDssddsdseeggdtgkpllrdldntpqdeaglkkmmkmttgrrkrr 570
gi 401396511 767 dktglrgkarIEevpappe---iqrptdPDEv------------------------------------------------ 795
gi 397611077 439 DSG-------FEvvssal-----pamddrKYDSENe-------------------------------------------- 462
gi 567996064  92 SDK-------FEvvaageepdenalpvmDERKYDSdheey---------------------------------------- 124
gi 672296070 235 dKTglrgktrIEevpppp----afqrptDPEEI----------------------------------------------- 263
gi 413946564 588 HDG-------FEivpaepvqneedssssSDESEDDidd------------------------------------------ 618
gi 224103395 608 END-------FEivpapatdssddsssdESEDddv--------------------------------------------- 635
gi 460409999 605 DDD-------FEivpapatdssdsssdeSDddi----------------------------------------------- 630
gi 586644804 599 QDD-------FEivpaegssssddsssdGDESEydt-------------------------------------------- 627
gi 403488644 141 EDD-------FEivpaermetsddssssSDESEEmdd------------------------------------------- 170
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121788993 571 RTRTgrpTEAMTLAHQLARGEKSTY-DIIDEGYNKHAFKDRDGLPDWFLDDEGQHDKPHKPISKEAAAAIKEKLRAYNAR 649
gi 401396511 796 -------AEIQALGSLLVQ-KSARM-DLIDGAYNRFAFND-DALPEWFEEDEKVHLRPELPVTKELMREYRQKLLDISRR 865
gi 397611077 463 DYDSddhARTLALGTMILRRSKEK--QLVDASYNRYAWNDPSDLPDWFVDDENRHHRPQLPIPPELLEKMRQKVLHLATK 540
gi 567996064 125 --daedrAKTLALASMMIHKSKAK--DMIDASYNRYAWNDSEALPDWFADDEEKHYRPQIPIPKNVLAQMKERFMEMATK 200
gi 672296070 264 -------AHIQALGSLMV--QKSTRmDLLDGAYNRYAFND-DALPEWFAEDEEAHTRPELPVTKELMREYRQKLLDISRR 333
gi 413946564 619 ----yrkAEVLAYAKKML-RKKQRE-QILDDAYNKHMFDD-EGLPNWFVEDEKRHRQPMKPVSREEVAAMRAQFKEIDAR 691
gi 224103395 636 ----dskAEILACAKKML-RKKRRE-QMLDDSYNKYMFDD-EGLPGWFVEEEKRHCQPIKPVTKEEIAAMRAQFKEINAR 708
gi 460409999 631 ----dtkAEILSTAKMTL-KKRPRE-EMIDDAYNRYMFHD-EGLPKWFVDEEKRNFQPVKPVTKEEIAAMRAQFKAIDAR 703
gi 586644804 628 ----dskAEILAYAKKML-RKKQRE-QILDDAYNRYTFDDQEGLPVWFLEDEKRHNKPLKPITREEVEAMKAQFREIDAR 701
gi 403488644 171 ----dskAEILAYAKKML-RKKQRE-QILDDAYNKYMFDD-EGLPKWFADEEKQHCQPTKPITREEVAAMRAQFREIDAR 243
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121788993 650 PIKKVAEARARKKFKQAQKLEKLKKKADLLAGDEGMSEKEKASSIAKLMSAA--GRKKRKAPVKVVKAAGMNRGLSGRPK 727
gi 401396511 866 PIRKVQEARARKKLREKRRLQKVKSQAAAVAESTEFTEAAKARAIDKIARQA--RRADGKRGKDYVVTRRVGGGKLAQKK 943
gi 397611077 541 PIAKVAEARARKNKMAKTKLAAARRKAEAVANSGEMSEAMKLKAISKAMR----GKEAKKPGKTYVVSKKGGGTKGAKGV 616
gi 567996064 201 PVKKVAEARGRKQRLQMKKLKAAKKKATDIANLPDMSTREKLKAIDRAMKGAr----lKKESKVYVVSTRGGTKTAGGKK 276
gi 672296070 334 PIRKVREARARKKMREQRRLQKVKSQVAAVAESTEFTEASKARAIDKIARKArhAEE-KRGK-DYVVTRRVGGGKLAQKK 411
gi 413946564 692 PSKKVAEAKARKKRVAMKKLDKARQKADAIADQNDINELSKRKMIDRIYRKA---MP-KKPQKEYVVAKKGVQVRAGKGK 767
gi 224103395 709 PAKKVAEAKARKKRVAARKLEKVRKKANDISKQTEISDHSKGRLIEQLYKKA---AP-KRPKKEYVVAKKGVTVKVGKGK 784
gi 460409999 704 PAKKVAEAKAHKKRAAHRKLEKFRKKANSISDQTEISEGSKRKMIEQLYRKA--AST-KKPEREYVVAKKGVQVKIGKGK 780
gi 586644804 702 PAKKVAQAKARKKRVAMRKLESVKRKANSISDQTDISERSKTKMIDKLYKKA---AP-KRPNKEYQVAKKGVPVKPGKGK 777
gi 403488644 244 PAKKVAEAKARKKRAAMRKLEKVRQKANTIADQTDISERSKGKMIDRLYKKA---MP-KKPKKEYVVAKKGVRMKGGKGK 319
                        250       260       270
                 ....*....|....*....|....*....|.
gi 121788993 728 -GVKG-----RYKMVDPRMKKEMRALKRIAK 752
gi 401396511 944 aGKKGdg-nnRVKLVDRRLKKDKRAMKAAMk 973
gi 397611077 617 ------------KLVDRREKNDKRALERttk 635
gi 567996064 277 -AGKG-----KVKLVDPRMKSDKRNAEIrak 301
gi 672296070 412 -AGKKgggnnRVKLVDRRLKKDKRAMKAAMK 441
gi 413946564 768 ------------VLVDPRMKKDKRASGTGKk 786
gi 224103395 785 ------------VLVDRRMKKDARGMGkpgk 803
gi 460409999 781 ------------VLVDPRMKKDARKHGMKKK 799
gi 586644804 778 ------------VLVDPRMKKDMRTHgmgkp 796
gi 403488644 320 ------------VLVDRRMKKDARSRgtgrp 338
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap