Conserved Protein Domain Family
Afi1

?
pfam07792: Afi1 
Docking domain of Afi1 for Arf3 in vesicle trafficking
This domain occurs at the N-terminal of Afi1, an Arf3p-interacting protein, is a protein necessary for vesicle trafficking in yeast. This domain is the interacting region of the protein which binds to Arf3, the highly conserved small GTPases (ADP-ribosylation factors). Afi1 is distributed asymmetrically at the plasma membrane and is required for polarized distribution of Arf3 but not of an Arf3 guanine nucleotide-exchange factor, Yel1p. However, Afi1 is not required for targeting of Arf3 or Yel1p to the plasma membrane. Afi1 functions as an Arf3 polarization-specific adapter and participates in development of polarity. Although Arf3 is the homolog of human Arf6 it does not function in the same way, not being necessary for endocytosis or for mating factor receptor internalization. In the S phase, however, it is concentrated at the plasma membrane of the emerging bud. Because of its polarized localization and its critical function in the normal budding pattern of yeast, Arf3 is probably a regulator of vesicle trafficking, which is important for polarized growth.
Statistics
?
PSSM-Id: 311642
View PSSM: pfam07792
Aligned: 24 rows
Threshold Bit Score: 80.1985
Threshold Setting Gi: 122108826
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74613799   125 YILVASFDIDRGPVMEHQYPVAITG------------DEHM--LAELMLPDQAHARNQ---DWTIF-------------- 173
gi 74694807    52 YILAAEFDNKLGPVLKHQFPKNLPGfk--------stNSNLsnLAGLMIPNGIENRPGe-sDFTTF-------------- 108
gi 74606087    31 FIIAAEFDNKSGPIIKHQYPKTIPGfkt------igsDSTCshLASLMIPNSVENHPGk-pDFTVF-------------- 89
gi 122108826    4 VIFCSEFDLLKGCVVKAHYPENfe------------yDEIT--LAAYMLPDGVQKFDN---DISVF-------------- 52
gi 124474398    4 ALFAAEFLV-KGCVITASYPQT--G------------DSGFheLASYMIPDGVHKIKQ---DKFFFrignvrfvsgqvqt 65
gi 255717154   32 YIISAEFDNKVGPVIKHQHPKPLAGfks------stsRSASvnLASLMIPNSAESRPDv-aDFTVF-------------- 90
gi 156838628   76 FILSAEFDNKLGPKVKFQYPNSIPGfpsslh-gahslDSTIn-LASLMIPNNVEYTPGk-kDFTVF-------------- 138
gi 254585239   11 YLLTAEFDNRFGPVVRDQYPSVIPGfeyemr-eghsqNNAVfnLASLMIPNNAEYNTGdepDTTVF-------------- 75
gi 290981124   63 YIFLAEFDIDKGSIVKVQYPSPYP-------------YATEysIANLMLPDGSHNCIE---DTTVF-------------- 112
gi 768475013   29 YIISAEFDNKLGPILKHQYPKDIPGfnqfsheqrngnTSVSmnLASLMIPSSIERNPGk-qDITVF-------------- 93
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74613799   174 ---------FLHKDSSREEDEADRqaK----------------------EERRRRRKR--------RQDReqgiihesdd 214
gi 74694807   109 ---------ILYKDRYAQTFQLFPndNakgslkptae---shghlggspSSRLES------------------------- 151
gi 74606087    90 ---------VLYKNQNV--YQLFPvsKnk------------------tkGTDLDS------------------------- 115
gi 122108826   53 -------------------------------------------------KYKLKQVVD--------QKTH---------- 65
gi 124474398   66 yhfdyqwkpLLQSSNQTLSYSD---------------------------DNVLKIRGE--------KESEwldin-lsna 109
gi 255717154   91 ---------ILYKDKYTRNYHVFP--I-----------------------ADSKLPQN--------DARS---------- 118
gi 156838628  139 ---------MLYYNTSTKLYQLFK--P----------------------SNIKTEVQKndnddnddEENE---------- 175
gi 254585239   76 ---------MLYRNRETVKYELFP--S----------------------Kqvdqvicfvnvvyaqedksnsrgtnikava 122
gi 290981124  113 ---------FLRGNNEINNNHHNEnnTsasslnnsnsgnnnssilsngsNDGGEEAKS--------SPRNsqe------- 168
gi 768475013   94 ---------TLYYNKFTQNYQLFPvpKdprfsfnlhhreqsdgsvtnsiYYDAENHQD--------AKNNr--------- 147
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*
gi 74613799   215 eDD------DLddddw---dddeSTDEDEpeggEGPpLV-YVLNL 249
gi 74694807   152 --MileedeNAgsskt-------------slsqAREiPL-FFINV 180
gi 74606087   116 -SLiieeedFEeeqenglrsgkiGSIRDDrhleETEpPL-FFLSV 158
gi 122108826   66 ------------------------KLVSEinlnSSKeLV-DLYKF 85
gi 124474398  110 qIHvishdfVSitlnpdliygikGKFTQD-----------YYLAC 143
gi 255717154  119 -PTileedePQsgl------ageAS-TNHna-dTKEpPL-FFLSV 153
gi 156838628  176 -DGdgdddsEYids------eifTDAKDEndnlDDIdTL-YFINV 212
gi 254585239  123 lgttmvdfiafkpfvleclhkfmklknkdditpmlkscfkllnra 167
gi 290981124  169 -------vvEKvdlntslestilSSDQVIteqsKKEeIFyYVLNV 206
gi 768475013  148 yTIvleddeLEc-----------QEVQNNqnaiDNE-PL-FFINV 179
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap