Conserved Protein Domain Family
DUF1633

?
pfam07794: DUF1633 
Protein of unknown function (DUF1633)
This family contains sequences derived from a group of hypothetical proteins expressed by Arabidopsis thaliana. These sequences are highly similar and the region concerned is about 100 residues long.
Statistics
?
PSSM-Id: 116408
View PSSM: pfam07794
Aligned: 2 rows
Threshold Bit Score: 922.748
Threshold Setting Gi: 75100217
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75216143   1 MTRLFSAPHLTAQIRRGEEISTISKIVVMMAsLNNFPHLHSISRQLTRLP------------------------------ 50
gi 75100217   6 MERLFSAPHLTVQIRRGEEISAISKIVVMMA-LNNFPPLHLTSRQLTQLSrsrknlvfifllspsflcysllldlpsllf 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75216143  51 --------------SDLDDSQNKSNHSYGDDDSSSKMRSAassrqepRRVITLGGMGPIRRPSTRVDKPKKKKAPKQKGS 116
gi 75100217  85 sfnslvllcrkpkmSDFEDSQNKSNHSYGDNSSSSPPRVQ-------KRVITLGGMGPIRSPSTRADKPKKKKAAKQGGG 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75216143 117 LPMTNNDLevldsgggdydtpkvaaVTQERAGGVGLCLRQFLREmwavlpdsgvhprdallPRLRLsSNVSkfrpprAG- 195
gi 75100217 158 TPMTNSDL-----------------VDLRRRCQVPVEVHMILSR-----------------PPLHL-ENVS------VGw 196
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75216143 196 -VIYPGLRGEQRIRLPRPAAalsgqdqrqeRPRDVlhkcsswisdprwseGLSGYKLASQILLLQGghhsvgdfdparit 274
gi 75100217 197 cCAYANFFEKCGLFFPIPAS----------RTKEV---------------TLSQTELELLTLLRRG-------------- 237
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75216143 275 rtcknqrnhffrdetlsvdpssklSNRLATFNRDRNVTALPIDPADPVIALPAAQPDPLEEVPQLYFRPSAYFQKkneVT 354
gi 75100217 238 ------------------------QTDWSTFSRDRIVAALAVAPAVPAIVPPTAQLDPIEEVPRIEPVPQADLPI---IP 290
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75216143 355 KSSCSTSQ--------CGT----------SARAGDLSAVVAAARTSLAASHTQASTSHPSLPAANarpllrrrarllpvv 416
gi 75100217 291 PDSSSTSElplirrmrCPSlhvqranaeaHARADDLSAAVTAARNTLAVSNASASASHPSLPEVN--------------- 355
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75216143 417 rltaelividqevapsreervkplAANPEAAVSVdrrssgrsqgrgrgsrgrgpnrsqevrqtsnlgggSAGNRpfhwsy 496
gi 75100217 356 ------------------------TGTSAAAVAI-----------------------------------AATNK------ 370
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75216143 497 thdrdhpiiedkaglanLLRHIKGRNCQVPgdccykqvgcslraTSKQGSFGERARRREDPHLGVDSEREVRSGARgivp 576
gi 75100217 371 -----------------LVALYEQRLSQVP--------------SASELEEGKTLIRELTSSVKAGQDREVSFQAE---- 415
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75216143 577 gMLRLKMELSTSKDLEKGYAEKIKIMEQEFRGLEADKQMARNQIHRLNEKKDELSKRVLDLTSIAQGVNKAVHDAKVELA 656
gi 75100217 416 -IERLKIELSTSKDLEKGYAEKIGFMEMEFGGLQADKQTARSQIHRLEQRREELSKKVMDLTSSAQGAKKAVHDAKVELA 494
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75216143 657 ASYSKLLSGIKDKWVAKKEFTVLESQAAEVESNLALIDQIVKAAVDLTVEKPRFQAEIDDVEARCTLKEVSDFTLSKLDI 736
gi 75100217 495 AAYLKLLAGIKEKWVTKKEYTVLEGQAAEVESNLALIDQITKAAIDLTLEKPRLQAELDDLEARCKSKEVSDFTLSKLDL 574
                       810       820       830       840       850
                ....*....|....*....|....*....|....*....|....*....|....
gi 75216143 737 PEVSEMLVVRPMNVDEQGTPIGLDEFGSNKDTFPRGLEEDPGTVFATPAGGSKE 790
gi 75100217 575 PHVSEISVVRPIDVDEQGTPIGLDEFGSNKDAFPGGLADGSGTVFAMPAGESRE 628
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap