Conserved Protein Domain Family
DUF1640

?
pfam07798: DUF1640 
Protein of unknown function (DUF1640)
This family consists of sequences derived from hypothetical eukaryotic proteins. A region approximately 100 residues in length is featured.
Statistics
?
PSSM-Id: 311647
View PSSM: pfam07798
Aligned: 99 rows
Threshold Bit Score: 111.042
Threshold Setting Gi: 761904965
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74581953   41 FNSLRFVRVLQEAGIDDKKSETLMRLISNVYSDMHEKISDFSVTKEQQDRVMYQQKVDFAHLRSELQSIERQEMVALHSQ 120
gi 213407756  68 MDTFNFVQQLKAAGFSNEKSEAIMDVTSLFILENIKRGKMSFLSIANFENYTYLFKTALAELRSEKIYLRKDQISSLRAG 147
gi 260946031 110 iDTYEVYKQLTRAGFTAEQSNEIIDLLVYQLNTKLSKLSTKYSQIYELENEQYLFESAQQELRVDITRNREQHINDAVTK 189
gi 210075377 183 FNTYQVFDELKEGGFDDEQAHQMVGIIGDMVKYKIGDILENYFPMLDSDNEAYLFEAACSELRTEVQKMREADVNERQLE 262
gi 761904965  56 FDTNLMIKQLQQMGFSQIQSEGLVAILIKLGSQKADLSSKDL------DLLELRIKSNIEAVKHSQVLLKEGSLSQLRDK 129
gi 149248320 167 LDTYSVFSKLKEAGFTDAQADSIIYLLIYQLNSKLSKLSTIYAQQYELESEQYLFESAQQEIRVDITRSREQHINELITL 246
gi 629722948 194 FDSYSLVKQLEEGGYSREQAVTSMKAIRKILGQNLDVAQKSLVSKSDVENETYLFQAACSELSTEIKNNRRLQEEEMRQQ 273
gi 517314109 162 FDTYSLVKQLQEGGYTQEQATTSMKAIRTLLAENLEIAQSTLVSKSDVENETYLFTAACSELSTEIKNNRRLEEEQLRQQ 241
gi 927387733  34 FDTYSLVKQLHEGGYSSDQATTMMKAVRALLAHNLDMAQEKLVSKSDVENESYLFSAACSELSAEIKNNRRAQDEQIRQQ 113
gi 512194369 391 FDSYSLVRQLEAGGYKQEQAITAMKGVRLLLAQNLEVAQSSLVSKSDVENEAYLFKAACAELSIEVRNNRRRADEQMRQQ 470
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74581953  121 VEQLFSDVERLKTSFRDQLNNSTSEARLQLNIDRLNHYDETASQDL-KLRELSAEIDTEM-S-NFRTQLASFKTQTLQW- 196
gi 213407756 148 LFSSQRQVEALEQTITEQLNKLSADWKMDFETRKNEARSDNQNIHA-KTQELSNRLAISL-G-NLRAEIEKQKWEQMRR- 223
gi 260946031 190 INALETDYEVISDELNNHFIQMKNDVQVAINDQKSDNTLKSKKIML-RIQETNHKITTEL-NmAMRSEIESLRWHLSRWg 267
gi 210075377 263 IDSFQKDMEEFEQDVNSLLIDMRNNIDILLSERKNENDEVLKHTDI-RIQEVNNSIVVDAnH-RMKPVIEEFRWVLMRN- 339
gi 761904965 130 SDDLRAEIGRLKENLKDEVTKINSGVQLDINLERSCIVEDSNGIQQgRYTEIYNRwcfhngfcisgnmetfemiynfaid 209
gi 149248320 247 VNILERDFNIITDELNNDYLKLKNDSQVAINEQKSENTLNVKKLFL-RIQETNHKITTELdS-AIRSEIESLRWYLSRW- 323
gi 629722948 274 RTHLQHEVDILTQSLNQELLTLNDAVRGLFNDRNMAVREEQKSVES-AIQKINYKMSILLsS-DSKSEIEGVRWVLIRR- 350
gi 517314109 242 RTHLQHEVDILTQSLNQEVHTLNDNVRGSFNDRKMAVREEQKSVES-SIQQINYKISIVLsS-DAKSEIEAVRWILIRR- 318
gi 927387733 114 RTHLQHEVDILTQTLNQELLTLNDNVRGAFNDRKMTVREEQKGADS-AIQQITYKISIMLsS-DSKSEIEGVRWILIRR- 190
gi 512194369 471 RTILQSEVDIAAQSVNQELVALTDVVKGLFNDRKMAVREEQKALES-AVQQLNYKITIMLnS-EMRSEIEALRWVLIRR- 547
                        170
                 ....*....|....*....
gi 74581953  197 VFGIVTGSGALLLAYv-rL 214
gi 213407756 224 ASGVILIFMAFVLmslsfg 242
gi 260946031 268 LIAIMASVCASSVTIyvyr 286
gi 210075377 340 GLFLIFSVAVMLLGTl-yL 357
gi 761904965 210 sff---------------- 212
gi 149248320 324 GL----------ITLlvsL 332
gi 629722948 351 SVVGLVFLAILTLGM---I 366
gi 517314109 319 SVLGILFMAVLTLGT---L 334
gi 927387733 191 SVVGILFMAIVTLGT---I 206
gi 512194369 548 SVLGIIFMVMLTLGS---L 563
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap