Conserved Protein Domain Family
DUF1644

?
pfam07800: DUF1644 
Protein of unknown function (DUF1644)
This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, and is probably a zinc-binding domain.
Statistics
?
PSSM-Id: 311649
View PSSM: pfam07800
Aligned: 66 rows
Threshold Bit Score: 246.294
Threshold Setting Gi: 242075974
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75335498   39 EEARCPVCMEHPHNGILLICSSYENGCRPYMCDTSHRHSNCFDQFRKASKEKPSLSLLREEEESNEPTEMEDVDSDstav 118
gi 685257628  25 DDLVCPICLDSPHNGVLLQCSSYQNGCRAFVCNTDHLHSNCLHRFITACSTDSPPSTSPAAPEDNDETLSKV-------- 96
gi 571459416  11 EDVICPICLEVPHNSVLLQCSSYDKGCRSFVCDTSQLHSNCLDRFKSTHSMPSSSTYDSTSQMSDANSMANSESVV---- 86
gi 356552573  21 DDVACPICLDFPHNSVLLHCSSYDKGCRAFVCDTNQLHSNCLDRFKNSCGMPSSPVSNATSTETTENSDDHEV------- 93
gi 255574097  28 EEVVCPICLDFPHNSVLLQCSSYEKGCRPFVCDTDHLHSNCLDRFKSASGMSSPSTSDATTTANTQHSV----------- 96
gi 460415421  16 DDVFCPICLDFPHNGVLLQCSSYDKGCRPFLCDTDHLHSNCLERFKQAHRVIAGSPSLSISNEREDVIK----------- 84
gi 573948213  29 EDVTCPICLDYPHNAVLLRCTSYEKGCRPFVCDTDQTRSNCLERFKGAYELP----ANMKVSTIAVAPLDSIHIVA---- 100
gi 226501110  30 EDVACPICLDSPHNAVLLRCASYEKGCRPFICDTDQTRSNCLERFRGAHGLPLPVPANARASSRTVAPLNSIHTITis-- 107
gi 695044026  64 KDVTCSICLDFPHNGVLLLCSSYDKGCRPFICDTDQNHSNCLERFKSAHGVPAVAKDISASNGVSMVCIQDIS------- 136
gi 695077165  27 DDIVCPICLDVPHNAVLLHCGSYDQGCRAFMCDTDDYHSNCLDRYKCAHGLPTITTVSSTTTGTPTQSIRVIP------- 99
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75335498  119 nllgeaaseitvvdlsdgergeeeveeeeeevvveeeeegivtteedqeKNKPQKLTCPLCRGHIKEWVVVKAARCFMNS 198
gi 685257628  97 -------------------------------------------------LEESCKPVCPLCRGEVTGWVVVEEARALLDE 127
gi 571459416  87 -------------------------------------------------SDCQYKLSCPLCRGDVFGWIIVDKARVHLDE 117
gi 356552573  94 -------------------------------------------------SNGQCNLTCPLCRGEVSGWVIVDKARIHLDE 124
gi 255574097  97 -------------------------------------------------VDGNSRLACPLCRGEVSGWVAIEKARVHLDE 127
gi 460415421  85 -------------------------------------------------SEANSWSACPLCRGKVTGWVVVEKARIHLDV 115
gi 573948213 101 -------------------------------------------------PNVNNRPSCPLCRGDVIGWIVINEARLHLNQ 131
gi 226501110 108 -----------------------------------------------ssNANNNRPACPLCRGDVMGWFVIGEARSHLNQ 140
gi 695044026 137 -------------------------------------------------SSPSSQPTCPLCRGDVTGWLIIDEARVYLNT 167
gi 695077165 100 -------------------------------------------------LGSGSSPTCPLCRGNVTGLVVVDEVRAYLNM 130
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 75335498  199 KHRSCSCETCDFSGSYSDLRKHARLLHPGVRPSEADPERQRSWRRLERQSDLGDLLS 255
gi 685257628 128 KHRSCEEERCRFIGTYTELRQHAKSEHPDSRPSKIDPARKLDWENFQQSSEIIDVLS 184
gi 571459416 118 KKRCCEEEQCAFIGSYSELQKHAQLEHPHACPSKIDPVRQLDWKNFQQSSEIIDVLS 174
gi 356552573 125 KKRCCDEVRCTFMGSYLELQEHAQLEHPHARPSKIDPARQLDWENFQQSSEIIDVLS 181
gi 255574097 128 KKRCCEEEQCTFTGTYLELCKHAQLEHPHARPSKIDPARQLDWENFQQSSEIIDVLS 184
gi 460415421 116 KERCCEEDKCKFKGTYVELQKHAKLDHPHARPSKIDPARQIDWENFQQSSEIIDVLS 172
gi 573948213 132 KKRCCEEDCCSFVGNFNELQKHTQQKHPDSRPSEIDPARQVDWENFQQSSDIVDVLS 188
gi 226501110 141 KRRCCEESRCSYVGSFHELQRHTQQKHPDSRPSAIDPARRADWENLQRSSDVVDVLS 197
gi 695044026 168 KKRCCEEKHCEYVGNFSELQKHAQLKHPHSRPSEIDPAQQLNWENFQQSSEIIDVLS 224
gi 695077165 131 MKRCCEEKQCLYVGNYMELQRHAKQEHPHSRPSKVDPDRQQDWENFQRSSEMIDVLS 187
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap