Conserved Protein Domain Family
DUF1647

?
pfam07801: DUF1647 
Protein of unknown function (DUF1647)
The sequences making up this family are all derived from hypothetical proteins expressed by C. elegans. The region in question is approximately 160 amino acids long. The GO annotation for this protein indicates the protein to be involved in nematode larval development and to have a positive regulation on growth rate.
Statistics
?
PSSM-Id: 311650
View PSSM: pfam07801
Aligned: 32 rows
Threshold Bit Score: 174.329
Threshold Setting Gi: 541041784
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74959280   35 CVCKSAITGKSYNFCYRDPQNLNSIGKKFNCSLLSTLEDL--------------GIISD-HSRLSNVTDVLRNQSNVVFA 99
gi 75023311   68 CECISSWTGKSYDFCYRNPKNATLVGKRFNCTWLSTLEDL--------------KLVGLhEQSLVDLYEYEKNDSDVIFV 133
gi 75028562   61 CGCKSTVTGKLYDFCYKLPEDEKSIGKKFDCKFVEEWEKI-----------------ES-STKFVDLQN--DSLPEPVFV 120
gi 341875937  64 CACRSNVTGKIYDFCYKLPEDHKKVGKRFDCERVEDWERI-----------------ES-ESKFIDLKT--ENAPEPVFV 123
gi 308462062  65 CACKSTVTGKIYDFCYKLPENPKTIGKRFDCKYVDDWERVgnqfifdlpypdhaHFPES-PSKFIDLHT--EAAPEPVFV 141
gi 541041784  42 CVCIYA--GLEYDFCYRLDENVSIRGRKMSCTSASIIYKL--------------GLIGEdSNHYVDLRH--EEIPSPVMV 103
gi 32567013   64 CECVSSRTRESFDFCYKNPKNVSLVGKRFNCTWLSILEDL--------------KLIGShEQIMVELKRPVKNDSDIMFV 129
gi 308506947  98 CECISSRTRKSYDFCYRNPKNPSLIGKKFNCSYVSALEDL--------------KLIDSsEQSLVDMTKAERNEKDVIFV 163
gi 341875177  99 CECVSNKTKKSYDFCYRNPKNSSLIGKRFDCTHLDALEEL--------------KLLDFsDQSLVDLSNPNRDASDVMFV 164
gi 308474279  71 CECISKKTQKSYDFCYKNPKNSSLIGRRFNCSYLKILEDL--------------KLVDApDQSLVNLANPDRNET--IFV 134
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 74959280  100 SSTSDDHMHLSLKSYKSVRRFHPRHKYILYGLNMSEAFIEKLPqRDKHFEFRVFNTSQYPSFVNNWLTYNFKPLLMA 176
gi 75023311  134 SATSRDHLANFNSMYAIVKHHWPRQKLILYSLDLTDKDILDIE-KEPNVKVRKFDYSKYPKYVKNLMEYRFKALILA 209
gi 75028562  121 TAFNNPFIRNGKRLISSIRRLGFHNKIILYNLGIEKENLKALE-NSCILEIRHFNFTKYPGYVRNLKSYRWKPIVIA 196
gi 341875937 124 TAFSDSFVNNGKRLISSIRELGFHNKIILYDLGIKKDNLELLQeKACALEIRSFNFTKYP-FEKDLRSYRWKPIVIA 199
gi 308462062 142 TAFNNPFFRNGERLISSIRKLGFHNKIVLYDLGISKEHLEILRnKACNLEIRYFNFTNYPDYVKNLKSYRWKAIAIA 218
gi 541041784 104 TAFSQNHWDEGRRLISSIRRFWPEQLIIVYDLGLDEPIARTVR-KLLNVEYRKFKFHDYPSYVRRLLDFRWKPIVIA 179
gi 32567013  130 SATSKNHLFNFNEMYNIVHRNWPNQNMILYSLDLTDAQILDIE-KRPTVKVRKFDYSKYPNYVENWMEYRFKALILA 205
gi 308506947 164 SAISSNHFGNFKEMYATIKRHWPMQKMLLYSLDLSESQIETLG-KEPSVEIRKFDYSKYPKYVQNWAEYRFKALLLA 239
gi 341875177 165 SAISMNHFGNFKEMYALIKKHWPQQKLVLYSLDLPDIRIKELE-ADPNIQVKKFNYSKYPKYVENWAEYRFKALILA 240
gi 308474279 135 SAISDNHFGNFKEMYKLIKQHWPNQKVILYSLELSAIYIKKLK-TERNVEVREFDTSKYPKHVKNWAEYRFKALILA 210
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap