Conserved Protein Domain Family
RED_C

?
pfam07807: RED_C 
RED-like protein C-terminal region
This family contains sequences that are similar to the C-terminal region of Red protein. This and related proteins are thought to be localized to the nucleus, and contain a RED repeat which consists of a number of RE and RD sequence elements. The region in question has several conserved NLS sequences. The function of Red protein is unknown, but efficient sequestration to nuclear bodies suggests that its expression may be tightly regulated or that the protein self-aggregates extremely efficiently.
Statistics
?
PSSM-Id: 311655
View PSSM: pfam07807
Aligned: 18 rows
Threshold Bit Score: 200.325
Threshold Setting Gi: 198429453
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75023280   428 YDECYPGGLVEMGGAWDSDEE-ADYSKMDAGPK-KNqAVNRWDFDTEEEYASYMEGREALPKAAYQYGVKNGEgGRKNKK 505
14_pfamImport   1 YAECYPGLDEMQDAIDDSDDE-VDYTKMDQGNK-KG-PVGRWDFDTQEEYSQYMNTKEALPKAAFQYGVKMAD-GRRTRK 76
7_pfamImport    1 YAECYPGMAGYVGALVDSDDEgGDLNHMDSKQA-KG--KTRADFATDEEWQRYKESRETLPRAAFQYGVKRAD-GRKSHK 76
12_pfamImport   1 YSECYPGYQEYNNEIAGSDDE-DDLSKMDMGGRaKG-RLHRWDFETEEEWAKYNDQKEAMPKAAFQFGVKMQD-GRKTRK 77
15_pfamImport   1 YAECYPGAPETADAIDDSDDE-VDYTKMDMGNK-KG-PIGRWDFDTQEEYSYYMNQKEALPKAAFQYGVKMAD-GRKTRR 76
gi 196015322  433 YAECYPGAMEVDDAMADSDEE-ADYSKMDMGNK-KG-PVGRWDFENEEDYNKYMEKREALPKAAFQFGVKMAD-GRKTRR 508
gi 675885422  399 YAECYPGMMESVDALGDSDDE-ADYTKMDQGNK-KG-PVGRWDFETQEEYSTYMSAREAMPKAAFQYGVKMAD-GRKTRR 474
gi 156372858  417 YAECYPGAMEVADTTYDSDDD-ADYTKMDLGNK-KG-PIKRWDFEDEEQYNSYMETREALPKAAFQFGIKMSE-GRKTRR 492
gi 260812447  424 YAECYPGMGEILGG-DDSDDE-VDYTKMDQGNK-KG-PIGRWDFDTQEEYSEYMSNKEALPKAAFQYGIKMAD-GRKTRR 498
gi 780165381  494 YFECYPGAMETADALDDSDDD-VDYSKMDQGNK-KG-PVGRWDFDTAEEYSDYMNQKEALPKAAFQFGIKTSE-GRKTRR 569
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 75023280   506 QS---A----VSDAKRLDRELNEINKIMDKRKAGGDGAGGGGD 541
14_pfamImport  77 HNk--E----KNERAELDREWNKIQNIIQKRKDPDSSNLGTPQ 113
7_pfamImport   77 ELekgAvveqRQRDQKLDGQLRKIERLLQDKGHDHGQAFARK- 118
12_pfamImport  78 QN----------KDQKLTNDLHKINKILARKKGEKDGAEDGGH 110
15_pfamImport  77 TGq-gK----KDEKAELDREWQKISKIIAKRKGTNLDMGEPDY 114
gi 196015322  509 QG---V----KDDKSKLDREWQQISNIIKKRKEMGTGGPVSGS 544
gi 675885422  475 AG---P----RDDKKELDREWSKIQNIISKRKPGDDIALGNYK 510
gi 156372858  493 TG---P----KDEKTKLDRDWQRISRMLATKSKSEEDGERGGK 528
gi 260812447  499 AG---P----KDEMKELDREWKKIQNIIEKRKTksgggasssa 534
gi 780165381  570 TH---Pe---KNEKAALDREWQKISQIIAKRKETGEGRRPVDS 606
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap