Conserved Protein Domain Family
TfuA

?
pfam07812: TfuA 
TfuA-like protein
This family consists of a group of sequences that are similar to a region of TfuA protein. This protein is involved in the production of trifolitoxin (TFX), an gene-encoded, post-translationally modified peptide antibiotic. The role of TfuA in TFX synthesis is unknown, and it may be involved in other cellular processes.
Statistics
?
PSSM-Id: 336821
View PSSM: pfam07812
Aligned: 78 rows
Threshold Bit Score: 154.569
Threshold Setting Gi: 503631809
Created: 26-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123509127  50 DGYFGELPSVWHKEILY-ALEHDVAVAGGASMGALRAAECAPFGMVGLGSIFEDYESGRLLDDEAVALVHAPQALGWLPL 128
gi 81710515   56 DGIFHQFPSVGHIELRT-ALKKGWRVWGLCSMGAIRACEMRDLGMRGYGTVYERFVQDEDFTDDEVALLHGPAH-PYPSI 133
gi 505022629  56 DGFFDSSTAVWHKEILW-ALEAGVRVFGASSMGALRAAELQVFGMEGFGSIFTAYREGQYIGDDEVAILHSSAQSQYQPL 134
gi 312169877  67 DGFFYGKLSVWHKEILY-ALDSGIVVIGASSMGALRAAELQGTGIIGAGTIFGWYRDGLIDGDDEVALLHESTQDNYTGL 145
gi 503940841  54 DGVFHQTAPVRHKEIID-VLARRTRVIGASSMGALRAAELWPYGMEGVGLVFGMYAQGELDSDEEVAVGHLPSG-EHRQL 131
gi 966417680  50 DGNFSWVPSVWHKEILT-ALDYGIEVWGAASMGALRAAELDSFGMRGHGRIYEMYKNEEVDGDDEVAIAYSKF---NNVQ 125
gi 558532906  48 DGVYHQAPALRHKEILA-AMGRGLRVIGAASIGALRAVELAPYGMLGVGRIYTAYARGDIDGDDEVAVGQAPDG-EWDAL 125
gi 559034957  48 DGVYHHSPAVRHKEIIW-TLGRGIRVIGAASIGALRAAELSDCGMIGIGSVWHDYNTGLLDGDDEVAVAQLAGGDP-RAC 125
gi 161159642  54 DGVFSQQEAVPPREIVD-VLRDGATVIGASSMGALRAAECWPLGMRGVGAIYRLFRRGVLGSDDEVAVLMDP-DDSHRAL 131
gi 408363469  53 DGVFLQDYPPTPIEVYQlARKEGVLLAGAASLGALRAVELEKFGMVGIGRIFQLYKTGKVNADDEVAVTFAPEG-DYLLQ 131
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
gi 123509127 129 SVPWVDFEPTIDALYACGEISTGERKKLLLSGRFLHFSERT 169
gi 81710515  134 TEPLIHMRFALDDLVTRGGLSRREAAAVVEHLSRLWFGYRT 174
gi 505022629 135 TDALVNIRATVNHALSKNIIDSAQANLIISCAQGQFFAQRh 175
gi 312169877 146 TIPLVNLRWQLMRAVEDGLIDSRSEALIIDRAKQMCFTERT 186
gi 503940841 132 TVPLVNVRWTISNAVAGKALAPDDGATLLNAARTLHYTERS 172
gi 966417680 126 TIPLINIRLTLER------LNSINNETVLNSIRSIFYAERT 160
gi 558532906 126 TWPVVNLRHVLDLARSAEILDGERAARLLEALRAVHYPQRT 166
gi 559034957 126 TWPLVRVRQVLSHALRKNVVDAAQADRLLGTLADVYYAHRS 166
gi 161159642 132 TVALINVRHAVSMAVRAGRLDRATADRLTRAAIDLYYADRT 172
gi 408363469 132 SEAMIDIRYNLYLAHKKGVIGKKTKSALTHVAKRIYFPHRn 172
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap