Conserved Protein Domain Family
TfuA

?
pfam07812: TfuA 
TfuA-like protein
This family consists of a group of sequences that are similar to a region of TfuA protein. This protein is involved in the production of trifolitoxin (TFX), an gene-encoded, post-translationally modified peptide antibiotic. The role of TfuA in TFX synthesis is unknown, and it may be involved in other cellular processes.
Statistics
?
PSSM-Id: 311660
View PSSM: pfam07812
Aligned: 81 rows
Threshold Bit Score: 154.559
Threshold Setting Gi: 503631809
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123511099  47 DGGFEYAAPVWHKEILRALSLGVTVFGAASMGALRAAECHSFGMIGIGRIFEDYRTGRLVDDAAVALVHAPSGLGGKPLT 126
gi 122306684  53 DGVFEAQPSVWHHELLAALEAGVAVFGGASMGALRAAELASHGMVGVGRIFEWYRDGVVADDAEVALLHATAEHGYRPLT 132
gi 123499705  58 DGLFDTVPSVWPREVLAALDAGVAVFGGGSMGALRAAELAAHGVVGVGRVFAWYRDGVIDDDGEVALLHGRAEDGFRPFT 137
gi 81710515   56 DGIFHQFPSVGHIELRTALKKGWRVWGLCSMGAIRACEMRDLGMRGYGTVYERFVQDEDFTDDEVALLHGPAH-PYPSIT 134
gi 490585426  50 DGNFSWVPSVWHKEILTALDYGIEVWGAASMGALRAAELDSFGMRGHGRIYEMYKNEEVDGDDEVAIAYSK---FNHVQT 126
gi 312169877  67 DGFFYGKLSVWHKEILYALDSGIVVIGASSMGALRAAELQGTGIIGAGTIFGWYRDGLIDGDDEVALLHESTQDNYTGLT 146
gi 504014541  50 DGVFGQSLSVWHKEILYALHKGVAVYGASSMGALRAAECHPFGMVPVGEVARGYVDGRLTGDDEVALAHAGPEDGWFPLS 129
gi 504996632  50 DGVFLSLPSVWHKEILYAIEQAVAVYGASSMGALRAAETDVFGMVGVGEIYRMYANGELIDDDEVVTVHGPEDTGYCRLS 129
gi 505022629  56 DGFFDSSTAVWHKEILWALEAGVRVFGASSMGALRAAELQVFGMEGFGSIFTAYREGQYIGDDEVAILHSSAQSQYQPLT 135
gi 500745749  54 DGLFDTTPSVWHHELLAALDAGVAVFGGASMGALRAAELERHGVVGVGAIFRAYRDGALEDDSEVALLHGDAAHGFRPLT 133
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|
gi 123511099 127 IPLVNVSATLDAMERNELLSDQLRQIIEDAASAIFFKRRT 166
gi 122306684 133 VPLVNVRHVAAKAREAKVLSMSQARALVKAAAGIFYQERT 172
gi 123499705 138 LPLVQVRAALEDARASGEIGPAAARGVLSAAGAIPYTHRT 177
gi 81710515  135 EPLIHMRFALDDLVTRGGLSRREAAAVVEHLSRLWFGYRT 174
gi 490585426 127 IPLINIRLTLER------LNSINDETVLNLIRSIFYAERS 160
gi 312169877 147 IPLVNLRWQLMRAVEDGLIDSRSEALIIDRAKQMCFTERT 186
gi 504014541 130 EPLVNLRASMAAALAAGAVDRSLHDRVIAAAKALYFTERT 169
gi 504996632 130 EPMVNVRATFCRAKDEGIIDSTVCEQLSAIAKLIYFPERT 169
gi 505022629 136 DALVNIRATVNHALSKNIIDSAQANLIISCAQGQFFAQRh 175
gi 500745749 134 VPLVAVRAAAEAARAGRLLRPGEARAVVAGAEAIHYTERT 173
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap