Conserved Protein Domain Family
Toxin_13

?
pfam07822: Toxin_13 
Neurotoxin B-IV-like protein
The members of this family resemble neurotoxin B-IV, which is a crustacean-selective neurotoxin produced by the marine worm Cerebratulus lacteus. This highly cationic peptide is approximately 55 residues and is arranged to form two antiparallel helices connected by a well-defined loop in a hairpin structure. The branches of the hairpin are linked by four disulphide bonds. Three residues identified as being important for activity, namely Arg-17, -25 and -34, are found on the same face of the molecule, while another residue important for activity, Trp30, is on the opposite side. The protein's mode of action is not entirely understood, but it may act on voltage-gated sodium channels, possibly by binding to an as yet uncharacterized site on these proteins. Its site of interaction may also be less specific, for example it may interact with negatively charged membrane lipids.
Statistics
?
PSSM-Id: 311668
View PSSM: pfam07822
Aligned: 2 rows
Threshold Bit Score: 67.0625
Threshold Setting Gi: 128919
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                     10        20        30        40        50
             ....*....|....*....|....*....|....*....|....*....|....*
gi 128919  1 ASATWGAAYPACENNCRKKYDLCIRCQGKWAGKRGKCAAHCIIQKNNCKGKCKKE 55
gi 128918  1 ASSTWGGSYPACENNCRKQYDDCIKCQGKWAGKRGKCAAHCAVQTTSCNDKCKKH 55
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap