Conserved Protein Domain Family
PA-IL

?
pfam07828: PA-IL 
Click on image for an interactive view with Cn3D
PA-IL-like protein
The members of this family are similar to the galactophilic lectin-1 expressed by P. aeruginosa ((PA-IL). Lectins recognising specific carbohydrates found on the surface of host cells are known to be involved in the initiation of infections by this organism. The protein is thought to be organised into an extensive network of beta-sheets, as is the case with many other lectins.
Statistics
?
PSSM-Id: 116441
View PSSM: pfam07828
Aligned: 2 rows
Threshold Bit Score: 192.544
Threshold Setting Gi: 81419522
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4YW7_P        1 AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQgliCHDAFCGALVMKIGNSGTIPVNTG 80
gi 81419522   3 DWSGSVPANAENGKSTGLILKQGDTISVVAHGWVKYGRDNVEWAAPDGPVPNN---PQPSSIATLVAKIANKKFAIGNGV 79
                        90       100       110       120
                ....*....|....*....|....*....|....*....|.
4YW7_P       81 LFRWVApnnVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS 121
gi 81419522  80 LHKTVP---VDGELILLFNDVPGTFGDNSGEFQVEVIIESR 117
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap