Conserved Protein Domain Family
RanGAP1_C

?
pfam07834: RanGAP1_C 
RanGAP1 C-terminal domain
Ran-GTPase activating protein 1 (RanGAP1) is a GTPase activator for the nuclear Ras-related regulatory protein Ran, converting it to the putatively inactive GDP-bound state. Its C-terminal domain is required for RanGAP1 localization at the vertebrate nuclear pore complex, and is sumoylated by the small ubiquitin-related modifier protein (SUMO-1). This domain is composed almost entirely of helical substructures that are organized into an alpha-alpha superhelix fold, with the exception of the peptide containing the lysine residue required for SUMO-1 conjugation.
Statistics
?
PSSM-Id: 336830
View PSSM: pfam07834
Aligned: 14 rows
Threshold Bit Score: 229.136
Threshold Setting Gi: 597792251
Created: 20-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123908261  387 EEEEEEEKTELNQ---FSTPPSAPr---TPDVSSFLSFPSPDKLLRLGEKRSVLIQQQV--DVLDVCKTAEAFLKISSVY 458
gi 524983512  394 QESLTPKKIIDSQ---ASTPVPSP----PVDVATFLAFPSPEKLLRLGPKCSVLIAQQT--DTSDVEKVVATLLRISSVF 464
gi 942175574  404 eSPADQQIISSTG---GHTPVSSPp---LVDAATFLAFPSPDKLLKLGPKRSFLIAQQT--DVSDVEKVVQSFLKITSVY 475
gi 390333375  389 ESKDPHLQVKGTA---ISPRREETkymiPVTAADFLAFPTANKLQALGNQRAEKILQELgdEVYEESAGIKAFVKISSVM 465
gi 432870737  394 EEEEEEEEEEKSQvnkMSTPVSAPr---PPDVSSFLTFPSPDKLLKLGAKRALLVQQEV--DTTDGRKTAEAFLKIASVY 468
gi 348511273  396 EEEEEEEESTGNK---FSTPQSAPr---PPEVSSFLSFPSPDKLLKLGPTRALLIEQQV--DVSDAAKTAEAFLKIASVY 467
gi 612049132  393 EVTTPSKKILDTH---VGEPPSvl--csPSDVSTFLAFPSPEKLLRLGPKSSLLIAQQT--DTSDPEKVVSAFLKVTSVF 465
gi 1051200068 394 QESLTPKKIIDSQ---ASTPVPSP----PVDVATFLAFPSPEKLLRLGPKCSVLIAQQT--DTSDVEKVVATLLRISSVF 464
gi 183986703  404 ENRTKPNKI-SSH---VSTPAAPPk--lPVDASTFLSFPSPEKLVRMGPKRSTMIMQQI--DVADTEKVVQTFIQVSSVY 475
gi 597792251  390 HNCVNGTKENGKD---KGSPAKTNl--cSPDLISFFHSPTSEKLFNLGAKRTQLIEQQL--DFSDAARIADFFLQICSVY 462
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123908261  459 KDNdAEVKSAVLESIDAVLSKAFFTPSFQGLAFVSSLLVMVGLLKSEDKLKPVKVVPGHLLCLEHAVKQSYFPREHITVL 538
gi 524983512  465 KDE-APVKTAVHETTDALMKKAFGSATFNSDAFITNLLVHMGLLKSEEKIKTVPSLYGILMTLNHMVQQDYFPKSLAPVL 543
gi 942175574  476 KEE-TVVKSAVVETTDALLRKAFSSPAFHSADFISSLLVHMGLLKSEEKIKSVSSVYGPLVALNHVVQQDYFPRTLVPIL 554
gi 390333375  466 ESEnNDVKNAVYQCTDAILKKLFSSEKCTPESVVNALLVHLGLIKGEDKLRPVGDPSGMLLTLGHAVKQQYYPKSTAPIF 545
gi 432870737  469 KEEnNDVKRAVLDTIDALLSKAFNDTSFQGYNFVSALLVLLGLIKSEDKVKPVLVVPGHLHAIEHAVRQDYFPKESVAVL 548
gi 348511273  468 KEDnNEVKNAVLDSIDGLLRKAFTSSSFQGYSFVSSLLVLLGLIKSEDKVKPVIVVPGHLQALEHVVRQDYFPKESVAVL 547
gi 612049132  466 KDD-LAVKTAVQDAVDALMKKAFASATFNSNAFITRLLIHMGLLKSEDKIKAVPNLYGPLMALNHMAQQEYFPKSLTPVL 544
gi 1051200068 465 KDE-APVKTAVHETTDALMKKAFGSATFNSDAFITNLLIHMGLLKSEEKIKAVPSLYGILMTLNHMVQQDYFPKSLAPVL 543
gi 183986703  476 RDD-SEVKAAVEETIDGLMKKAFESRGFQENLFITSLLVHMGLLKSEDKIKTVQHLNGPLLTLNHMVQQNYFPKSLVPIL 554
gi 597792251  463 EEE-VEVKQVVLETADTLLRKGFSSPHFQTYLFISSLMVNMGLLKGEKKMKKMGVLPGHLIVLNHCVGQDYFPVDQADVL 541
                         170       180
                  ....*....|....*....|....*.
gi 123908261  539 NAFMSRPNKSLEVCSSARDRLKNTLQ 564
gi 524983512  544 SAFVTKPNRALDSCSFARHMLLQTLH 569
gi 942175574  555 TAFMSKSNRTLESCSFARHALLQTLH 580
gi 390333375  546 MTFLSRPNSKIDDCVSAKHGLMQAIY 571
gi 432870737  549 KAFMSRSSKSLESCGSAKNVLQSTLQ 574
gi 348511273  548 EAFMSRNNKTLEPCGNAKNNLQSTLQ 573
gi 612049132  545 LAFVTKPNRALEACSFARHNLLQTLH 570
gi 1051200068 544 SAFVTKPNRALDSCSFARHMLLQTLH 569
gi 183986703  555 LAFISKPNRVLENNASARHTLLHNLH 580
gi 597792251  542 LIFLSRNGKVLESCSKARDYLKTTLE 567
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap