Conserved Protein Domain Family
DmpG_comm

?
pfam07836: DmpG_comm 
Click on image for an interactive view with Cn3D
DmpG-like communication domain
This domain is found towards the C-terminal region of various aldolase enzymes. It consists of five alpha-helices, four of which form an antiparallel helical bundle that plugs the C-terminus of the N-terminal TIM barrel domain. The communication domain is thought to play an important role in the heterodimerisation of the enzyme.
Statistics
?
PSSM-Id: 311676
View PSSM: pfam07836
Aligned: 68 rows
Threshold Bit Score: 86.4125
Threshold Setting Gi: 81606218
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
4LRS_A       280 PWADRAAIVQGYAGVYSSFLLHAERAAERYGVPAHEILQRVGEAGYVGGQEDMIIDIAVQLAE 342
gi 81606218  267 PHIQPANIASGLYGLFSGYVPHIQKAAQEFGVNEFELYKRLAERKLVAGQEDIIIEEASRLAR 329
gi 263430494 268 PMIDSLGIVSGLAGVFSGFKSPVLNHAGSAGVDARDVFFELGRRQIIAGQEDLIVEVVAELKR 330
gi 81533186  271 PTIDSTSLVSGLAGVFSGFKKPVLAAAQRAGVSPWDVFVELGRRRVLAGQEDLIPDAINTLTS 333
gi 502700987 270 PHTDSVGIVSGLAGVFSGYSKPVRRIARDFGVDPRDVFFALGRREVIAGQEDVILEVAMALRD 332
gi 916887996 279 PLVDAVSLVSGLAGVFSGFKRKVLAAASEYGVSPWDIFFELGRMQAIAGQEDLIPIAAKHLAA 341
gi 503901511 274 PFIDSVAVMSGRAGVFSGFKNRVLDVAAREGVSPGDLFDELGHRQVIAGQEDLIPEAAHHLKE 336
gi 297162492 268 PVTGSLSIVSGLAGVFSGFKHQVLDHSGRAGVDPRDVFFELGRRQAIAGQEDLIVDVVAELSA 330
gi 223517450 292 PSISPLSIVSGLAGVFSGFAKPVARAAADYGVDARDIFFGLGKRNAVAGQESLIIEVARELAE 354
gi 503508897 270 PIIDNDSILMGYANVYGGYIHPIKQAAERYGCDPRALVLRLGERKVVAAQEDVVIEEAQRLAQ 332
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap