Conserved Protein Domain Family
CaM_binding

?
pfam07839: CaM_binding 
Plant calmodulin-binding domain
The sequences featured in this family are found repeated in a number of plant calmodulin-binding proteins, and are thought to constitute the calmodulin-binding domains. Binding of the proteins to calmodulin depends on the presence of calcium ions. These proteins are thought to be involved in various processes, such as plant defense responses and stolonisation or tuberization.
Statistics
?
PSSM-Id: 311678
View PSSM: pfam07839
Aligned: 58 rows
Threshold Bit Score: 60.3656
Threshold Setting Gi: 255548566
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75335803   297 KHESKEAEDWKEADGEkv-kERIKLVLKTEEAlLSLaqkpcnreeciEDCRRLNPREPNYIQttvePSNETVDLRHQD-- 373
gi 75181224  1130 EVSSATFKPKFTEKRVkg-wNNVKKVILLKRFvSDL-----------GSLTRLSPKTPRVLPwepdPETEKIRLRHQE-- 1195
gi 75181224   837 SNSLKEEKEHQGETKrs--wNSLRKVILLKRFvKSL-----------EKVQVPNPRKMRNLPvesaFEAENVFLRHRSim 903
gi 24637243   497 essnslkEEKEHQGETkrswNSLRKVILLKRFvKSL-----------EKVQVPNPRKMRNLPvesaFEAENVFLRHRS-- 563
gi 460408643  864 vANNPITESKFEPPKSks-wSKLKKLILLKRSiKVL-----------ERARKVNPQPPQLLPptpdQEQEKVDLRNQM-- 929
gi 460381657 1191 ERALPLAKNKPETQKSkn-wSKLKKLILLKRSiKAL-----------EKARKFNPRAPQFLPltpdQEPEKVDLRHQM-- 1256
gi 460381657  720 EITPKEVKNKSEKRAPkh-wSNLKKWILLQRFvKEL-----------EKVRRINTRKPQYLQlnpdPEAEKVNLRTQT-- 785
gi 255578435  757 eKAESKVERKANQQKPns-wSNLKKIIILRKFvKEL-----------EKVRNINPRKPQYLPgqpePEGEKIHLRHLA-- 822
gi 685379934 1138 RNSQVSEESSTNSKPKkg-wNNVKKVILLKRFvSDL--------------GRLSPKTPRFLPwepdPETEKIRLRHQE-- 1200
gi 566174408  499 EKAESSVESKSNQQTPks-wSNLRKILILKRFiKAL-----------EKVRNFSPQKPRNLNveadPEAEKVHLRHQT-- 564
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 75335803   374 MDE--RKKAEEWMIDYALQHTVSKLVVERKKDVALLVEAFETTVP 416
gi 75181224  1196 IGG--KRNSEEWMLDYALRQAISTLAPSQKRKVSLLAQAFDTIsl 1238
gi 75181224   904 EGT--RTEGEEMMLDYALRQAISRLAPIQRKKVDLLVQAFDIVLd 946
gi 24637243   564 IMEgtRTEGEEMMLDYALRQAISRLAPIQRKKVDLLVQAFDIVLd 608
gi 460408643  930 SNE--RKKAEQWMLDNAVQRMVSKLTPARKTRVAMLVEAFEAVVP 972
gi 460381657 1257 TDE--RKKAEKWMLDYAMQHIVTTLTPARKKRVAMLVEAFEAVVP 1299
gi 460381657  786 ADE--RKRGEEWMLDYALQQAISQLAPTQQRKVELLIKAFETVVP 828
gi 255578435  823 MGG--RKNSEEWMLDYALQQVISTLAPAQKRKVALLVQAFETVgp 865
gi 685379934 1201 VGG--KRNSEEWMLDYALRQAISTLPPSQRRKVSLLAQAFDTIsf 1243
gi 566174408  565 MGE--RKNSEEWMLDHALQQVISTLAPAQKRKVALLVQAFEKVTl 607
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap