Conserved Protein Domain Family
CaM_binding

?
pfam07839: CaM_binding 
Plant calmodulin-binding domain
The sequences featured in this family are found repeated in a number of plant calmodulin-binding proteins, and are thought to constitute the calmodulin-binding domains. Binding of the proteins to calmodulin depends on the presence of calcium ions. These proteins are thought to be involved in various processes, such as plant defense responses and stolonisation or tuberization.
Statistics
?
PSSM-Id: 336834
View PSSM: pfam07839
Aligned: 56 rows
Threshold Bit Score: 60.3638
Threshold Setting Gi: 255548566
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75335803  297 KHESKEAEDWKEADGEkvkERIKLVLKTEEAlLSLAQKpcNREeCI-EDCRRLNPREPNYIQttvePSNETVDLRHQDMD 375
gi 695046525 496 KLRFRRGKVIESQPES---NGPRRLTFRRGRvVA-VNGngGHV-RR-KSFRRIV--IDDEALkdpdHEAPTIVLRHQDMQ 567
gi 255547291 486 KLSFRKGKVLELCPVIt---SPKRLKFRRRHk---DSQisKVE-KIdRNFKNTGTHVDDGEIsvtkSEGKKVVLKHQKIE 558
gi 695064982 659 KLKFRRGKIIELQPECkglRRLRF----RRGrLMSKSAddDQV-ER-MNFQRSEMGAP---AsdpsPESKGVVLKHQDMQ 729
gi 566197136 206 KESSRSGKVFELHPEN---STSKRLKFTRR--ALNDGQmgEVDtSK-NNLK--NKEVCEGEAniakRESEKIVLRRKDVQ 277
gi 222624436 344 KLKFKRGKIVELQPDS---NGPRKLKFRR-R-SASEFSssEGLsAR-RIYKM--NSTIDAGPsnldVESPGVKLRHQDTQ 415
gi 670440234 636 KLKFKRGKIVELPLDS---MGPRRLKFRR-K-SANEASnrESQpAR-RIYRR--NNTSTAVPtd--vESPGVKLRHQDAQ 705
gi 566205605 253 KVNFRSGMVVELQPEN---RTSRRLIFRR-R-SLGEGQigETGtSK-DNLKS--KKVCENEAnsakMESEKVVLEHQDMQ 324
gi 970007249 584 KLKFRRGKVIDLQPET---SSPRRLTFRLGR-HMGESQdsNI--RK-RNFRK--KGVDDDGSnt-ipNSRKIVLRHQDVQ 653
gi 571496714 482 KLKFRRGKVVENQTEI---SSPRRLKFRRAR-VPREKAnvNSN-VR-KSFER--NVACDNSNda-ttGPEKVVLRHQDMQ 552
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
gi 75335803  376 ERKKAEEwMIDYALQHTVSKLVVERKKDVALLVEAFETTVP 416
gi 695046525 568 EKKDAQG-LFNNVIKETASKLVESRKSKVKALVGAFETVIS 607
gi 255547291 559 GKKVVKN-LLNNMIEETANKLAETKKSKVKALVGAFETVIS 598
gi 695064982 730 EKKDIQG-LFNNVIEETASKLVESRRSKVKALVGAFETVIS 769
gi 566197136 278 EKKIVQS-LLNNMIEETACKLVENRKSKVKALVGAFETVIS 317
gi 222624436 416 EKKDAQG-LFNNVIEETASKLVESRKSKVKALVGAFETVIl 455
gi 670440234 706 EKKDAQG-LFNNVIEETASKLVESRKSKVKALVGAFETVIS 745
gi 566205605 325 EKKNVQS-LLNNMIEETAVKLVESRKSKVKALIGAFETVIS 364
gi 970007249 654 EKKDVQG-LLNNVIEETASKLVETRKSKVKALVGAFETVIS 693
gi 571496714 553 EKKDAQG-LLNNVIEETASKLVEARKSKVKALVGAFETVIS 592
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap