Conserved Protein Domain Family
FadR_C

?
pfam07840: FadR_C 
Click on image for an interactive view with Cn3D
FadR C-terminal domain
This family contains sequences that are similar to the fatty acid metabolism regulator protein (FadR). This functions as a dimer, with each monomer being composed of an N-terminal DNA-binding domain and a regulatory C-terminal domain. A linker comprising two short alpha helices joins the two domains. In the C-terminal domain, an antiparallel array of six alpha helices forms a barrel-like structure, while a seventh alpha helix forms a 'lid' at the end closest to the N-terminal domain. This structure was found to be similar to that of the C-terminal domain of the Tet repressor. Long-chain acyl-CoA thioesters interact directly and reversibly with the C-terminal domain, and this interaction affects the structure and therefore the DNA binding properties of the N-terminal domain.
Statistics
?
PSSM-Id: 311679
View PSSM: pfam07840
Aligned: 25 rows
Threshold Bit Score: 204.375
Threshold Setting Gi: 501522626
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1HW1_A        72 NNFWETSGLNILETLARL-DHESVPQLIDNLLSVRTNISTIFIRTAFRQHPDKA-------------------------- 124
gi 1169604    77 NNIWDAAGPNIIETLIAL-DMQSAPLIIDNMLSLRSKMSESYIYEAVKNSPQKS-------------------------- 129
gi 81423249   84 NDVWETAGPNIISTLIKL-DKSYIPVIIANVVSLRTRMAESYIPEAIKLNPAQC-------------------------- 136
gi 75353746   72 NNYMETSGLHILDTLMTLvDANNATSIVEDLLAARTNISCIFMRQAFKTNKEGSlrtlnrviesceqllaaeswdsfiea 151
gi 34222527   72 NQFMETSGLHILDTLMTL-DVDNATNIVEDLLAARTNISPIFMRYAFKANKENSertiknviescealvnasswddfias 150
gi 81399138   72 NNYMETSGLSILDTLITL-DGQDVQSVLEDLLAARTDISSVFMRYAVKGNGKESseliehviqsceellnansfaefven 150
gi 753849451  73 NNIWETAGPNILKTLIQL-SPTLKPTVIANVVSLRTRMGEQFIPEAIKINPQQT-------------------------- 125
gi 500094007  72 NDFWETSSLNVLSTITRL-DIERRADYIDQLMSVRTNVSAIILRMAAKHNTKSV-------------------------- 124
gi 491795239  76 NDVWETAGPNIISTIIKL-DRSYLPVIIANVVSLRTRMAESYIPEAVRLNAEAC-------------------------- 128
gi 493291585  76 NDIWETSGPNIIGTIIKL-DKSYLPVVIANVVSLRTRMAEAYIPEAIYLAPEES-------------------------- 128
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1HW1_A       125 ----QEVLATANEVADH--------------ADAFAELDYNIFRGLAFASGNPIYGLILNGMKGLYTRIGRHYFANPEAR 186
gi 1169604   130 ----TALFAELEQLQNT--------------AQDYTEFDYQLFRQFTVVANKPFYRLIFNSLKGVYQRIGLLFFKEKKHR 191
gi 81423249  137 ----CPLFAQLDTLEDT--------------AEAYATFDYNLFRQLTFLANKPVYALILNSFKQMYHQVANLFFADPTCR 198
gi 75353746  152 spfgAKIKAEVKEDNEKdpvkr----eeiliAKTFNYYDYMLFQGVAFKSGNQIYGLIFNGLKKLYARVGSYYFSNSEAR 227
gi 34222527  151 spyaDKVLQSVKEDNEKdeakr----qeiliAKTFNFYDYMLFQRLAFHSGNQIYGLIFNGLKKLYDRVGSYYFSNPASR 226
gi 81399138  151 sddkLPLMQQVKKIVDKygktdpelceaicrARAFNYYDYRLFQGLAGKSGNKLYVLTINGLRKIYTRVGGYYFMSPEAC 230
gi 753849451 126 ----FEFFQSLDELDDD--------------EKSYAEFDYNLYHRFSFISDKPVYTLILNSFRTLYHQVAALFFINPQSR 187
gi 500094007 125 ----LSFLDKVPSIDAS--------------SEEFTEFDYRFYHHVAVSSNNMIYVLILNGLQDLYRRVGYFYFSNTEAK 186
gi 491795239 129 ----VAFFNQLDELEDT--------------ADAFATFDYKLFRQFTFTANKPVYALILNSFKGMYHQVASIFFADPVCR 190
gi 493291585 129 ----AKLFDGLDELENT--------------AAAYAEFDYKLFRQFTFLANKPVYALILNSFKSMYHQVAKIFFADENNR 190
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*...
1HW1_A       187 SLALGFYHKLSALCSEGAHDQVYETVRRYGHESGEIWHRMQKNLPGDL 234
gi 1169604   192 ELTKQFYLEMQQICLEGNADAVVDCIRKHNLRSSTYWKAILERLPQNL 239
gi 81423249  199 QLSLSFYRLLLSACVEENHEKAIQVLVDNRQLSSEIWVKLLQTLPEQF 246
gi 75353746  228 ELALQFYRDLKLICEEERKDAVMPRMRQYGMEGNLIWNEMKLNLPSNF 275
gi 34222527  227 DLALRFYRQLLETCETGQREQLPVVIRHYGMESAQIWNEMKKQLPTNF 274
gi 81399138  231 QLALDFYREMQSYCDNNQPDHVADRLKKYGRESGAIWYSNRIEIAHYL 278
gi 753849451 188 QVELTFYQQLKECCRNGDYQQASVYLVENRERSSAIWKGILTNLPENF 235
gi 500094007 187 SIALAFYADIKIVLEKGEIHQIMQVVRDSAFASGKIWLHLRHQLPDDF 234
gi 491795239 191 QLTLKFYRDLLNACVEKDHEKASLIMAQNRQSSSEIWGKLLQSIPENF 238
gi 493291585 191 QLTLSFYRSLLCTCLAKDSEKAAACMAKNRQSSGEIWQKLSANIPESF 238
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap