1HW1


Conserved Protein Domain Family
FadR_C

?
pfam07840: FadR_C 
Click on image for an interactive view with Cn3D
FadR C-terminal domain
This family contains sequences that are similar to the fatty acid metabolism regulator protein (FadR). This functions as a dimer, with each monomer being composed of an N-terminal DNA-binding domain and a regulatory C-terminal domain. A linker comprising two short alpha helices joins the two domains. In the C-terminal domain, an antiparallel array of six alpha helices forms a barrel-like structure, while a seventh alpha helix forms a 'lid' at the end closest to the N-terminal domain. This structure was found to be similar to that of the C-terminal domain of the Tet repressor. Long-chain acyl-CoA thioesters interact directly and reversibly with the C-terminal domain, and this interaction affects the structure and therefore the DNA binding properties of the N-terminal domain.
Statistics
?
PSSM-Id: 336835
View PSSM: pfam07840
Aligned: 24 rows
Threshold Bit Score: 203.993
Threshold Setting Gi: 501522626
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1HW1_A         72 NNFWETSGLNILETLARLDHESVPQLIDNLLSVRTNISTIFIRTAFRQHPDKA--------------------------- 124
gi 34222527    72 NQFMETSGLHILDTLMTLDVDNATNIVEDLLAARTNISPIFMRYAFKANKENSertiknviescealvnasswddfiass 151
gi 34222625    77 NNIWETSGLNILEVLVRLDSTKLPSFISNILSARTNISAIYIQKAFKVEPQKS--------------------------- 129
gi 1169604     77 NNIWDAAGPNIIETLIALDMQSAPLIIDNMLSLRSKMSESYIYEAVKNSPQKS--------------------------- 129
gi 81423249    84 NDVWETAGPNIISTLIKLDKSYIPVIIANVVSLRTRMAESYIPEAIKLNPAQC--------------------------- 136
gi 81399138    72 NNYMETSGLSILDTLITLDGQDVQSVLEDLLAARTDISSVFMRYAVKGNGKESseliehviqsceellnansfaefvens 151
gi 500094007   72 NDFWETSSLNVLSTITRLDIERRADYIDQLMSVRTNVSAIILRMAAKHNTKSV--------------------------- 124
gi 491795239   76 NDVWETAGPNIISTIIKLDRSYLPVIIANVVSLRTRMAESYIPEAVRLNAEAC--------------------------- 128
gi 493291585   76 NDIWETSGPNIIGTIIKLDKSYLPVVIANVVSLRTRMAEAYIPEAIYLAPEES--------------------------- 128
gi 1128926013  73 NNIWETAGPNILKTLIQLSPTLKPTVIANVVSLRTRMGEQFIPEAIKINPQQT--------------------------- 125
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1HW1_A        125 ---QEVLATANEVADH--------------ADAFAELDYNIFRGLAFASGNPIYGLILNGMKGLYTRIGRHYFANPEARS 187
gi 34222527   152 pyaDKVLQSVKEDNEKdeakr----qeiliAKTFNFYDYMLFQRLAFHSGNQIYGLIFNGLKKLYDRVGSYYFSNPASRD 227
gi 34222625   130 ---LEAFKDLDTLADT--------------AEAYTNFDYDLFRKLAFASDNPVYGLILNSLKGLYTRVGLFYFANPSARE 192
gi 1169604    130 ---TALFAELEQLQNT--------------AQDYTEFDYQLFRQFTVVANKPFYRLIFNSLKGVYQRIGLLFFKEKKHRE 192
gi 81423249   137 ---CPLFAQLDTLEDT--------------AEAYATFDYNLFRQLTFLANKPVYALILNSFKQMYHQVANLFFADPTCRQ 199
gi 81399138   152 ddkLPLMQQVKKIVDKygktdpelceaicrARAFNYYDYRLFQGLAGKSGNKLYVLTINGLRKIYTRVGGYYFMSPEACQ 231
gi 500094007  125 ---LSFLDKVPSIDAS--------------SEEFTEFDYRFYHHVAVSSNNMIYVLILNGLQDLYRRVGYFYFSNTEAKS 187
gi 491795239  129 ---VAFFNQLDELEDT--------------ADAFATFDYKLFRQFTFTANKPVYALILNSFKGMYHQVASIFFADPVCRQ 191
gi 493291585  129 ---AKLFDGLDELENT--------------AAAYAEFDYKLFRQFTFLANKPVYALILNSFKSMYHQVAKIFFADENNRQ 191
gi 1128926013 126 ---FEFFQSLDELDDD--------------EKSYAEFDYNLYHRFSFISDKPVYTLILNSFRTLYHQVAALFFINPQSRQ 188
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*..
1HW1_A        188 LALGFYHKLSALCSEGAHDQVYETVRRYGHESGEIWHRMQKNLPGDL 234
gi 34222527   228 LALRFYRQLLETCETGQREQLPVVIRHYGMESAQIWNEMKKQLPTNF 274
gi 34222625   193 LAKRFYLSLKTLCQTQQVNDVKECIRQYGKDSGVIWANMQAYLPANF 239
gi 1169604    193 LTKQFYLEMQQICLEGNADAVVDCIRKHNLRSSTYWKAILERLPQNL 239
gi 81423249   200 LSLSFYRLLLSACVEENHEKAIQVLVDNRQLSSEIWVKLLQTLPEQF 246
gi 81399138   232 LALDFYREMQSYCDNNQPDHVADRLKKYGRESGAIWYSNRIEIAHYL 278
gi 500094007  188 IALAFYADIKIVLEKGEIHQIMQVVRDSAFASGKIWLHLRHQLPDDF 234
gi 491795239  192 LTLKFYRDLLNACVEKDHEKASLIMAQNRQSSSEIWGKLLQSIPENF 238
gi 493291585  192 LTLSFYRSLLCTCLAKDSEKAAACMAKNRQSSGEIWQKLSANIPESF 238
gi 1128926013 189 VELTFYQQLKECCRNGDYQQASVYLVENRERSSAIWKGILTNLPENF 235
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap