Conserved Protein Domain Family
DUF1641

?
pfam07849: DUF1641 
Protein of unknown function (DUF1641)
Archaeal and bacterial hypothetical proteins are found in this family, with the region in question being approximately 40 residues long.
Statistics
?
PSSM-Id: 336838
View PSSM: pfam07849
Aligned: 81 rows
Threshold Bit Score: 31.2178
Threshold Setting Gi: 74544520
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30
                 ....*....|....*....|....*....|....*.
gi 74562907  113 DDAKPVGLFGLLNALRDPEVQRGLGFLIAVLKKLGS 148
gi 122538824 120 SPNAKTTIRSLLGVLKDDDMNRSLTYMLNMLKGMSR 155
gi 81385347  120 DSEEKTGYFDIIRSLKDPEINKAVTLLFSFLKGMGQ 155
gi 752595783 223 aaeKPIGIFGLLRALRDPDVNRAISFALHASKAYGQ 258
gi 504455859 120 SSKEKTSVLDLAKALKDPEINRSITMLMSFLKGMGR 155
gi 497478928 120 DTQEKTSFFDLARSLKDPEVNRAVTLLLTFLKGMGQ 155
gi 825271774 119 SPNQRTTVGSLVGLLKDEDANKSITYFLNILKGMSR 154
gi 504426053 119 SPHARTSVTGLMRVLKDDEMNQSLTYFLNLLKGMSR 154
gi 501505524 240 EKEQKPSLFGLLKELKDPQTLQSIMFVLALIKNMPQ 275
gi 502515177 121 ADGKPLGVFELLALLKDPNVSYAIRFLLGFLSGMGK 156
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap