Conserved Protein Domain Family
WND

?
pfam07861: WND 
WisP family N-Terminal Region
This family is found at the N-terminus of the Tropheryma whipplei WisP family proteins.
Statistics
?
PSSM-Id: 311693
View PSSM: pfam07861
Aligned: 3 rows
Threshold Bit Score: 360.331
Threshold Setting Gi: 81437715
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81437726  45 TPPALSLLSSVSSTSVSSNTKYTRVSNTNTQEVCVTTNTNVSLLIDPVTSSTKQTLSCTPSLLPQPQTHIYVPYTDTSSY 124
gi 81437715  37 TPPALSLLSSVSSTSVSSNTKYTRVSNTNTQEVCVTTNTNVSLLIDPVTSSTKQTLSCTPSLLPQPQTHIYVPYTDTSSY 116
gi 81437722  71 TPPALSLLSSVSSTSVSSNTKYTRVSNTNTQEVCVTTNTNVSLLIDPVTSSTKQTLSCTPSLLPQPQTHIYVPYTDTSSY 150
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81437726 125 LYVPYITNTHISLYYTDKKADPSSFLTFPHTDIATPYGDEKVISITKTTTNLIALLTTRNIFFFDIHVTEKPKITVPIHK 204
gi 81437715 117 LYVPYITNTHISLYYTDKKADPSSFLTFPHTDIATPYGDEKVISITKTTTNLIALLTTRNIFFFDIHVTEKPKITVPIHK 196
gi 81437722 151 LYVPYITNTHISLYYTDKKADPSSFLTFPHTDIATPYGDEKVISITKTTTNLIALLTTRNIFFFDIHVTEKPKITVPIHK 230
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 81437726 205 QIDNTYLSDIPSLRNSRYTFSLTHPNKDITIDRYTGQIHLSSLPTSPITAIAINRDTTTHITYAIDTHNPTtshRSKRE 283
gi 81437715 197 QIDNTYLSDIPSLRNSRYTFSLTHPNKDITIDRYTGQIHLSSLPTSPITAIAINRDTTTHITYALADEPRV---RTKRS 272
gi 81437722 231 QIDNTYLSDIPSLRNSRYTFSLTHPNKDITIDRYTGQIHLSSLPTSPITAIAINRDTTTHITYAIDTHNPTtshRSKRA 309
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap