Conserved Protein Domain Family
DUF1652

?
pfam07865: DUF1652 
Protein of unknown function (DUF1652)
This is a family containing hypothetical bacterial proteins.
Statistics
?
PSSM-Id: 311697
View PSSM: pfam07865
Aligned: 13 rows
Threshold Bit Score: 71.2154
Threshold Setting Gi: 500262249
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 123655462   6 LELRNIIESSFLPKRCQCTLSPDLSMTVKVFgDHQTDRVDLVVTGIDASQLNGCREINELIAELRYDL 73
gi 81731527    5 PDLQRVLETAFLPSRCECVIAANESFSVKLF-DPVSGDIQLSVAGMPLSELSTSRSIARLVLSLKEQR 71
gi 123654723   5 LELRRIVETSFLPLHCQCTVGHDGAMTVRIC-DPASGRVDLLVTGIATRGLTSSRALSELIAELRYDL 71
gi 123655073  32 SELCHILESGFLPLSCACALNPNGSLTIKIY-DAESGRVDLLLTGVSTAELTSVRDISNLIGELRTEL 98
gi 123656065   8 AQLRACIEQHLAPLACSFSNAGDGTLTLRVF-EPASGRVDLVVTGLSARALQSEADVQKIIDELLYEL 74
gi 81730999    7 PNACQLMRWHFHPVGFEATMDAPGSMIARLF-DRASGETVVAIAGLPCSTVMNAADVERIIEAIEDEL 73
gi 81440455   22 PNACQVMRWHFHPLGFEASMDAPRSMVARLF-DRASGETLLAIAGIPCAAIMAAADVERIIEAVEAEM 88
gi 81440575   54 LEMRQLIEQACLPDRCEVSCPDGAHLTIRLG-QGQDLDQGVTLNGVALQDLNSCRDLVNLVEQLHALR 120
gi 81730379    9 LELRSIVERAFLPSRCTCTI-ANQEMTVQIN-DLTSGRI-LHETGISLRRINTSRDISDLVARLRHGL 73
gi 654440255   5 LEQRHIVECAFLPLACSCSIDGSESVTIQIR-DPVTAQVYLNVTGISRAELSTSRQISQLVMQLRQDL 71
gi 503556671   6 LEQRQIVESAFLPLACRCTIGADDLVTLELR-DPDDDHLLLNVDGIHREELASSRSISQLVLRVRQQL 72
gi 333115075   7 LDAAALLYNYFQPLVVQVSLQSPTSMVVRL--SEKESETSLEVRDIPCRTSLTPTEVFAIIEQIEARi 72
gi 500262249   7 PEAFALVQQHYEPLVFNARMDSPTTVRVMLL-DEATGES-LLLTGLPCRISLSRAEIAGLIASIDADa 72
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap