Conserved Protein Domain Family
DUF1654

?
pfam07867: DUF1654 
Protein of unknown function (DUF1654)
This family consists of proteins from the Pseudomonadaceae.
Statistics
?
PSSM-Id: 311699
View PSSM: pfam07867
Aligned: 7 rows
Threshold Bit Score: 82.1063
Threshold Setting Gi: 81540905
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 81440220   16 TSFDLLAARIQKIINSPAAQKNRVAVIYKAPGESQEDWGALVEAMEGTEGVSLAFEDDGGVRVTWEK 82
gi 81540905   12 TAYDLLNTRIQRIIHAPAAQQACQACISRLPGEDEGDWAHLLESFDRSNQWLLDPQRDGSIVLRWSS 78
gi 123656626  19 SSYERLGVRIQKIINSPTAQKAKAALIFRLADEPQDEWERLLEEIAENDNVTLAYRDDGGVQIFWVV 85
gi 81731336   13 gPYERMGMRVQKIINSPTAQKSRAALLFRLPDESEDDWAQLLEEIAENDNVTLAWRDDGGVQIFWTL 79
gi 81729952   13 RSYEQIGRRIQRLVSAPDVQKIQWVIVTRQEDEARDGWDRVLQEISETEGIEVDWQRDGSVRIGWQR 79
gi 81440343   30 TGIERLSLRVSSMINHPLAQTQRWVVVHRLDSDGEAEWEEVMGQLLEMPELQLTFNDDASVTVRWAR 96
gi 908648688  19 SSYEQLGARVSRAINAPAAQRSRSAVLLRAEGDSPEDWARLLDEIAENDNVTIAWRDDG-VQLFWTV 84
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap