Conserved Protein Domain Family
DUF1656

?
pfam07869: DUF1656 
Protein of unknown function (DUF1656)
This family contains bacterial proteins, many of which are hypothetical. Some proteins in this family are putative membrane proteins.
Statistics
?
PSSM-Id: 311700
View PSSM: pfam07869
Aligned: 131 rows
Threshold Bit Score: 29.3188
Threshold Setting Gi: 739552474
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 81497938   4 QLDLYGIFLPSFAALALFAYGAFRVLASLLGKVGFYRAVWHRSLFNFALYIALVGG 59
gi 123739516  4 dLTLGGVLVPGLLGLALIALVATIAVIRLLSVAGLTRLFVSRPLVEIATFALIYAL 59
gi 81562538   4 DLNIGGVLIPGLVVVAFIGLIITIATMRVCTEIGVSRLFAYRPLAEIAIFVIVCGL 59
gi 501563273  4 dLTVGGVFVPGLVVLGFIALITTMALMRVCTATGISRLFAFRPLVEVATFLILYGL 59
gi 503965361  4 DLSVGGVLIPGLVVHAFAALGATMAVVRVLAATGIHRLLAYRPLVEPAIFVLIYGL 59
gi 504563808  4 DLNIGGVLIPGLVVLAFVALLVAVAMFRFFSATGIQRLFASRALVELATFVIIYGL 59
gi 504887967  4 DLCISGVFVPGLLGGAFIALVTTVALLRLLTVLGAWRVFSIRPLVELAVFTILFSL 59
gi 504565708  4 DLALGGVFIPGLLVLAVLALVATLLVIRVLVVTGLSRLFAGRPLVELAVFAIIYGL 59
gi 503954781  4 DLDIGGVFLPGLLVLALAALVGTVAVVRLFAAAGLFRLTASRPLVELATFALLFGL 59
gi 505735295  4 DINIGGVFLPGLLVMALMAFFGTILITPFLSFSPFYRRLPCRPLIDFTTFIIIFAL 59
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap