Conserved Protein Domain Family
DUF1659

?
pfam07872: DUF1659 
Protein of unknown function (DUF1659)
This family consists of hypothetical bacterial proteins of unknown function.
Statistics
?
PSSM-Id: 311702
View PSSM: pfam07872
Aligned: 81 rows
Threshold Bit Score: 32.0052
Threshold Setting Gi: 501110774
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*.
gi 81746022    6 LVDSMLQLTFSEGVDEEsGEPILTYKRFNQVKMEANHEQLYNVATA 51
16_pfamImport  1 NVRSRISIRLNGGTDQN-GKQVIKTASVSKVNGHMSAQDLQAVA-- 43
62_pfamImport  1 KVSSSVVIVINTGKDAN-GKDTSKKLNLGAVTTTAAEQDIYDVASA 45
18_pfamImport  1 NAECEIIIKVETGTTST-GKASYSSRSFGYINPSLAEDDILDIGQ- 44
gi 493767658   7 PVTSSIRLSLVTGLDTQ-GAPILKQTNLSNVKSNALDQDLFDVANA 51
gi 504619950   6 PIASRLTLRLQTGADEW-GKPKLKSKSIAGVDVGADASDVLTVAQA 50
gi 501110774   7 NQSSRVRLRFVEGVDGE-GKEKLSTKSYSNIRNQVTDEDLYAVAvd 51
gi 1025899932  7 KLSSTLSIVEKTGLNKQ-GKEILKKVTLGKIAMDAADQDVYDVVKA 51
gi 503928391   6 PVQSRLNIRVQVGTDAE-GKPVLANLNIRDIDPAATAEAIASVTQA 50
gi 502814142   6 PMESRLQIRVNIGFDDN-GDPVTRSLNFADVQSEAVALNVAAVSAA 50
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap