Conserved Protein Domain Family
Coat_F

?
pfam07875: Coat_F 
Coat F domain
The Coat F proteins, which contribute to the Bacillales spore coat. It occurs multiple times in the genomes it is found in.
Statistics
?
PSSM-Id: 336845
View PSSM: pfam07875
Aligned: 237 rows
Threshold Bit Score: 28.6206
Threshold Setting Gi: 81389242
Created: 26-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 81480753   8 TDKEIMMNILGSYKLAIEMLSHAAVEAANESIRREYINLLNSTLEDQRTVWTAVNQRGWYPVK 70
gi 81529616  16 TNKDIASDFMMNLDDFIVSLSTATCQTMNPQLRQVFDAQLISAINNQHNLSDMMVKKSWYPAF 78
gi 551002677  8 TEKDIALDLLTSSKASIATLTKVLTETTNPQLRDTLKSELTTCINSHYRLSDLSINKGWYNAQ 70
gi 505208287 16 TEKDIAQDILKDSKFAVTSLASAAAEAINPELRDMLRTQLDKAVSDHFELSDMIVDRGWYPAK 78
gi 504715996  9 SDQDIVNDMLKDSKFAIHSLSVALGESTSTVFREKLVNQLNTCIDDHFKLSDFAAQKNWYQPY 71
gi 501007844 10 SEKDIALDLMTSSKATITTLAKVLTETTNSELRDTLKGQLTACVNSHYRLSDIAVNKGWYNAN 72
gi 505208285  9 TEKDIALDLITSSKTTITTLSKTLTEATNPQLRETLKNQLTACVNSHYRLSDISINKGWYNAH 71
gi 551002679 15 TEKDIAQDMIKDSKFSATSLSAAAAEAVNPEIRAMLRKQLDKALTEHFELSDMVINKGWYPAQ 77
gi 524549633  2 NEKLAMDSVLSCTNSIITLLNYSIQQANNKNFRDTLIEQRNTLENLQWKVYLIDKEKGYYipa 64
gi 501007846 16 AARDIAQDMLKDSKFAVTSLAAAAAEAVNPELRELLRGQLDKAVAEHFELSDIVVDKGWYSAK 78
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap