Conserved Protein Domain Family
Coat_F

?
pfam07875: Coat_F 
Coat F domain
The Coat F proteins, which contribute to the Bacillales spore coat. It occurs multiple times in the genomes it is found in.
Statistics
?
PSSM-Id: 311704
View PSSM: pfam07875
Aligned: 236 rows
Threshold Bit Score: 28.619
Threshold Setting Gi: 81389242
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 81480753     8 TDKEIMMNILGSYKLAIEMLSHAAVEAANESIRREYINLLNSTLEDQRTVWTAVNQRGWY-PVK 70
gi 502723443   15 NDEVIATDLLVTAKAAVRSYAVAITETASPEIHKILKKQLDETIQLHHEVATYMIEQEMY-HAY 77
gi 402253069   32 vDSTIALSFLLNAKSGIKNCATALTEIADPEARKEIRNMLNAQIDLHAQISELMMNKGWF-HPY 94
gi 315472088    7 TEQSVATDLLLSAKTAVRNCAYALTECTSDNVRKTINQQLQQAIVFHENVADYMINKGYY-HPY 69
gi 501423723   10 SDKDMLNDLLSTTKHVSSVYHQGVLEANSQDTRQAFFDLHDHTLEQHLNMLETMKSKGWY-QPE 72
gi 1005268824  18 aDSAVALEFLMSIKTGIRNAAAAITESRTPAVRAAFQKQLAEGLSLHEEVSNFMMQKGWL-HPY 80
gi 754073662   17 VDANMSLGFLLNAKSGVRNCAIALTESATPQVRSVLKEQLDHAIDLHEEISNLMIEKGWLhPID 80
gi 737319447   17 VDANMSLGFLLNAKSGVRNCAIALTEVTTPEVRHILEKQLYDAINMHEEISDLMIKKGWFhPLN 80
gi 495682592   17 TDSGVALEFLLTTKTGIRNLSIALTETASPALQKIMRTQLDVMIDLYFEISDLMQKKEWLkPFN 80
gi 503680496   17 TDSMLSLDFLMAAKNGVRNCAIALTECITPEARTLIREQLNQALALHEEISQLMLSKGWLhVYN 80
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap