Conserved Protein Domain Family
RHH_5

?
pfam07878: RHH_5 
CopG-like RHH_1 or ribbon-helix-helix domain, RHH_5
This family contains bacterial proteins that form a ribbon-helix-helix fold. This fold occurs in many examples of bacterial antitoxins.
Statistics
?
PSSM-Id: 311706
View PSSM: pfam07878
Aligned: 18 rows
Threshold Bit Score: 46.4928
Threshold Setting Gi: 122418672
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|.
gi 81593040   15 TKRTTIVLPDAVYEDLQLWADEEGRATANLVAFLVEQAIRA 55
gi 81711015   20 LDRVVAYVPTELKKELEQWAEAEERSVSWLVAKLIDRALQQ 60
gi 81576180   82 SNKVQISVPSNLNYLLKVWAAAEGRDLSSVAFQCLETGLRE 122
gi 123620546  14 SPRIQVVLPEDLCERLSELAERESRTVSNMAKVLIQEGVKY 54
gi 81665134   14 SPRVQVVLPEELCAQLTFLAKKESRTVSNMAKVLIQEGVDS 54
gi 158310325  15 MTRINITVPEDLLEEFKEYCDSQVRSVSSQIQFFMKQAVES 55
gi 298235181   6 GKRVNVTFPVEVYERVAGLASDETRTVSQMIVVLCQEAMVA 46
gi 317162231   6 NTRISVTVSKDNRDKLKELAKKENRSMSNMVEHLITSYIER 46
gi 760054821  14 SPRIQVVLPEALLERLAVAADQDSRTVSNMAKVLIQQGLDR 54
gi 504990361   7 rGRVTAYLPEEIQKALEEWAEEDSRSVSSLATYLLTKSVRE 47
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap