4NV6


Conserved Protein Domain Family
VKOR

?
pfam07884: VKOR 
Click on image for an interactive view with Cn3D
Vitamin K epoxide reductase family
Vitamin K epoxide reductase (VKOR) recycles reduced vitamin K, which is used subsequently as a co-factor in the gamma-carboxylation of glutamic acid residues in blood coagulation enzymes. VKORC1 is a member of a large family of predicted enzymes that are present in vertebrates, Drosophila, plants, bacteria and archaea. Four cysteine residues and one residue, which is either serine or threonine, are identified as likely active-site residues. In some plant and bacterial homologs the VKORC1 homologous domain is fused with domains of the thioredoxin family of oxidoreductases.
Statistics
?
PSSM-Id: 336848
View PSSM: pfam07884
Aligned: 291 rows
Threshold Bit Score: 37.9366
Threshold Setting Gi: 501195802
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4NV6_A        21 LILAILAGLGSLLTAYLTYTKLt---eQP----AAf--CT-GDGg--CDLVLSSRW-------------A---------- 65
gi 514695024   3 LLVILTALAGVGVCAFALYVEHe---aTThedyKAp--CD-ISEhmsCTRVFTSQW-------------Grgygiiapll 63
gi 340381892   5 svysFLSGLGFLVSVYSVVIEHak-leDDs--ySPl--CD-INErisCTAVLTSEY-------------Sygfgivelil 65
gi 568251492  19 vgLVCLSAVGFLLSLYTSYVELra-eqDRs--yRAm--CD-ISErisCTKVFTSSYgrgfgimgkvfgpA---------- 82
gi 119113533  14 LALVGLSVCGFLLSLYTSYVELra-ehDHt--yQAm--CD-ISErisCTKVFTSRY-------------Grgfgivgpll 74
gi 167537292  91 LVVVALSALGLALCVYTLHVARsarrsPGk--yRAw--CD-VSSavsCSRAFTSPY-------------Avgfgllepll 152
gi 401413484   6 FTVVVTSALGVALCLYAINVEQnsv-rdAt--yRAf--CD-FSPyasCSKVLTSTQ-------------Srlltyf-gia 65
gi 641661624   9 rIIKAYSLVGFCVAAYALYVEIsle-nyPd--fKPl--CD-LREyikCSPAFISPY-------------Akgfgivryif 69
gi 299117259   3 tslqAMGAIGLCLSLYAVYVEHkne-edSs--yEAm--CD-VSErmsCSKVLMSEW-------------Ghilsql-gvl 62
gi 237836713   8 sAVALLALCGLMVSLYCVHVQQh---lERh--lAYkpyCDiAPSm-mCSKVALSPY-------------S---------- 58
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4NV6_A        66 ---EF-----L----G-IPTA--AVGLLGFLGVLA----LAVLPdglpLVKRW----------RWPALFGLVS--AMTAF 114
gi 514695024  64 gedSP-----L----N-MPNP--YYGILFYVALLV----KELVL----PRSRV----------LDLMCFAATL--VAVGM 111
gi 340381892  66 nkdHF-----L----N-QPNS--YYGVLFYPLQFI----IGLYI----LESKG----------LLSLSALLNT--GVSAV 113
gi 568251492  83 ---SP-----L----N-VPNG--FYGIFFYFVVAG----LSFSD----NV--R----------VARLNSYLIL--AANGL 125
gi 119113533  75 gddSL-----L----N-VPNG--FYGIFYYFLVAG----LSFSN----NL--A----------VSRLTSYLIL--LSNGL 120
gi 167537292 153 grdSP-----L----N-LSNA--YFGLPYYILMLM----DGL-C----G---IdaqpgtwaniVHQLALPASL--LATGA 206
gi 401413484  66 apdGH-----F----D-FPNT--YLGLFFYAFMLtfpr---------------------grqyCHCLYTLAAA--AAMAS 110
gi 641661624  70 gedSA-----F----N-VPNG--LTGMLFYTLSFV----LSCSD----Sd------------kLVNIHYYLTI--ASNVS 115
gi 299117259  63 pkgHQ-----F----D-LANA--TLGVLYFAAVFL----HRL-F----P---Lssc-----qaKAKVVFALTV--PVVGV 111
gi 237836713  59 ---HMlslfgLaephGrMDVAngHLGVAFYAFMLTypfgKQAFE----N-------------------IYFLGttTALVV 112
                        170       180       190
                 ....*....|....*....|....*....|....
4NV6_A       115 EMYMLYLMVAVLRQFCMYCTTAIILVAGLGLVTV 148
gi 514695024 112 CAYLAYILAFVLEDFCAVCVSSYVINAALLFLLW 145
gi 340381892 114 SLYLMYLLFFVINKVCLVCLVINSINFFLLIYSI 147
gi 568251492 126 SLYLAYLLYFVLEDLCLVCVSTYAINLISLILAL 159
gi 119113533 121 SLYLAYLLYFVLQDMCVVCVTTYAVNLVSLILAL 154
gi 167537292 207 SLYLAWVLAARLHVTCIVCVASYSVNLALAVLAy 240
gi 401413484 111 SIYLAYVLYAVLHDFCLVCVTSYVLNLILLAVTL 144
gi 641661624 116 TFYLAFVLVFVVQELCLVCLTTYFINAISLLCVs 149
gi 299117259 112 SLYLMYILLVVLQDICLICVSIYGVNLAVLVLSY 145
gi 237836713 113 SGYLCYLVYSALSVVSIISASIVIVNALLFITIF 146
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap