Conserved Protein Domain Family
BA14K

?
pfam07886: BA14K 
BA14K-like protein
The sequences found in this family are similar to the BA14K proteins expressed by Brucella abortus and by Brucella suis. BA14K was found to be strongly immunoreactive; it induces both humoral and cellular responses in hosts throughout the infective process.
Statistics
?
PSSM-Id: 311713
View PSSM: pfam07886
Aligned: 65 rows
Threshold Bit Score: 40.1257
Threshold Setting Gi: 503185247
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30
                 ....*....|....*....|....*....|
gi 123512234 155 AAARCAARYRSYRPEDNTYQPWDGPRRSCE 184
gi 81635306  142 HVSWCLSRYRSYNPASNRYLTYGGVYRVCY 171
gi 123513338 102 HIAWCTNEYRSYNPRTDHFLTYEGVYRVCR 131
gi 75544212  212 HVRRCFDRYSSYDPDSDTYIGRDGYSHYCR 241
gi 81780481  105 HVSWCADRYRSYNPDDNSYMSYSGQQRPCv 134
gi 123162215 122 HIAWCSERYRSYDPVDNSYNAYSGETRECv 151
gi 503418674 123 HVRWCLNRYRSYNPATDMYLGFDGRYHYCR 152
gi 754049155 104 HVRWCMDRYRSYDPQTNRYIAGDGRMRVCR 133
gi 947874869 110 HVDWCRNQYRSYNPKTDRFVTFEGIYKTCN 139
gi 563751370 119 AVERCAARYRSFDRRTGTFLTYGGERRLCP 148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap