Conserved Protein Domain Family
CALCOCO1

?
pfam07888: CALCOCO1 
Calcium binding and coiled-coil domain (CALCOCO1) like
Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein coexpressed by Mus musculus (CoCoA/CALCOCO1). This protein binds to a highly conserved N-terminal domain of p160 coactivators, such as GRIP1, and thus enhances transcriptional activation by a number of nuclear receptors. CALCOCO1 has a central coiled-coil region with three leucine zipper motifs, which is required for its interaction with GRIP1 and may regulate the autonomous transcriptional activation activity of the C-terminal region.
Statistics
?
PSSM-Id: 311715
View PSSM: pfam07888
Aligned: 10 rows
Threshold Bit Score: 627.261
Threshold Setting Gi: 972964507
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123887473    3 KCVEFRNVGCSYFPQSRVDCHYTISSQHTWASNDWVGLFKMGWTSVRDYHTFVWALVPPS-YEEGTEVNCCVQFQAAYLP 81
gi 160016577    5 WRVEFRNVGSCYFPQSRVDCHYTINPQHTWASNDWIGLFKVGWSSVKEYHTFVWAVAPSS-YKEGTSVNCCVNFQASYLP 83
gi 160017736   13 GGVNFLNVARTYIPNTKVECHYTLPPGTMPSASDWIGIFKVEAACVRDYHTFVWSSVPES-TTDGSPIHTSVQFQASYLP 91
gi 542210213    5 WQVEFRNVGCSYFPESRVDCHYTLSSRHIWASNDWIGLFKEGWTSVKDYHTFVWALAPAD-YQEGTDVNCCVQFQASYLP 83
gi 47228659     3 ERVQFRNVGCSYFPQSRVDCHYTIASQHTWASSDWVGLFKVGWSSVKDYHTFVWALVPPN-YEEGTEVNCCVQFQASYLP 81
gi 551523523    5 WRVEFRNVGCAYFPQSRVDCHYTLSSQHSWVSSDWIGLFKVGWSSMKDYETFVWALAPAD-YQEGTEVNCCVHFQASYLP 83
gi 637263541    8 PGVTFLNVAPSYVPHTKVECHYNLPPGMKPSARDWIGIFKAEASSVRDYYTFVWCTVPDGgTPAGALLHCSVQFQASYLP 87
gi 821489940   13 GAVTFLNVARTYIPNTKVECHYTLPPGIVANASDWIGIFKTEASSVRDYHTFVWCVIPEG-AAEGSAIHSSVQFQASYLP 91
gi 1040657740   5 RFVHFRDVAVSYFSQTRVDCRYTISSQHDWSSRDWIGLFKVGWLTVKDYYTFAWALAPEG-YQKGADANCSVAFHPSYLP 83
gi 972964507    9 wRVEFRNVGRSYFPQSRVECHYSMSPLHCWASSDWIGLFKVGWSSTRDYHTFVWALSPEG-YSEGTSANGCVHFQACYLP 87
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123887473   82 KASCHEYEFVYISAKGEVCSRSSSFIFCAPKPLEDLVTLEEDSHG--EEGGTDMLLVVPRAELLQN--------RLQECL 151
gi 160016577   84 GPSAQQYQFVYVDGKGEICSCSAAFTFSAPKPLEELVTLEEEGQG--EEVGEDMLLVIPRAQLLQS--------RLQECL 153
gi 160017736   92 KPGAQLYQFRYVNRQGQVCGQSPPFQFREPRPMDELVTLEE------ADGGSDILLVVPKATVLQN--------QLDESQ 157
gi 542210213   84 KPSSQEYEFVYIDAKGKVCSRSSKFTFCAPKPLEDLVTLEEDSHG--EEAGTDMLLVVPRAELLQN--------RLQECL 153
gi 47228659    82 SPSCHEYEFVYVSAKGEVCSRSSKFTFCAPKPLEDLVTLEE-SHG--EEEGTDMLLVVPRAELLQVsrtqnrliRLQECL 158
gi 551523523   84 KPSSQEYEFIYVDAKGEVCSRSSAFTFCAPKPLEDLVTLEDESHG--EDGGTGMLLVIPRAELLQS--------RLQECL 153
gi 637263541   88 KPGPQQYQFRYVDRRGEVRGQSSSFQFNEPRPMDELVTLEEASD---DGAGTDMLLVVPKATLLET--------QLEESR 156
gi 821489940   92 KPGAQFYQFRYVNHKGRVCGQSSSFQFREPRPMDELVMLEE------SENGSDILLVVPKATVLQN--------QLEESQ 157
gi 1040657740  84 IPGVEEYQFVYVDERGDVCAISSQFTFTAPRPLDELVTLEKTGEG--EEDGDDLLLVVPKALILQN--------LLEGCQ 153
gi 972964507   88 GPGEDSYQFVYVDQRGEVCARSAPFAFCAPKPLDELVTLEERREGeeEEEGEGMLLVIPRAELLQA--------RLEECL 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123887473  152 QERAELLQAHEATNRQREKDKLEYKRAREAWDRRRSEVESDISRLQRELKHSHE--------QIKSMErkqeEEQDLVEL 223
gi 160016577  154 KERAELLQALEAADQNVEREKGRRERDRGSWEHTRKELERKIDDLKEEVREYRE--------KVEDMKkkqkEVEDLGEA 225
gi 160017736  158 QERNDLMQL------------------KLQLEGQVTELRSRVQELERALATARQ--------EHTELMeqykGISRSHGE 211
gi 542210213  154 RERAELLQVQEAVKEQREKEKEEYKRAREAWDRRRKELEGDIARLQKELKQTLE--------KLDELEkkqkEEKALGES 225
gi 47228659   159 QERAELLQAHEAANRQREKEKMEYRGAREAWDRRHRELESEISRLQRELNRSFR--------QTQDMQrkqeEEQDLVEL 230
gi 551523523  154 QERTELLREQEAAKKQRERDREDYKREKQQWDRQRRGLEREVSRLKEELAQSDQ--------KIEEMEmkqkDETALRDC 225
gi 637263541  157 QQQGVLLQE------------------SCRLKDEVKELRSHMAELEAALGSLRD--------DHTKLAaqykELSDSSAE 210
gi 821489940  158 QERNDLMRL------------------KLQLEGEVAELKSRVQELETVLQVTKE--------EQTKLMekykGLARAHGE 211
gi 1040657740 154 RELHELHKKFEAVNGDVENERQRWKTDRDEFEILRSDMRSQIEELKTNLRHSTE--------KTEELEqkhkEAQISSES 225
gi 972964507  160 RERAELLQAREASQRGREED-------REEWDRQRRELSERLGRAREEASRLREtrqreaelD----------------- 215
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123887473  224 LTQEKSTLLEANEESRVRIRELEEDIKTLTQRTVDRETEMERMKERAK-------RAGAQRKEEESERSALQ-------- 288
gi 160016577  226 LTEEKRALLAQKEANEQRIRELEEDIKILTQRGLERETDLERMRERAK-------KSAAQKREDEDEHKNLKlkmeqtek 298
gi 160017736  212 ITEERDILSRQQGDHVARILELEDDIQTISEKVLTKEVELDRLRDTVKaltreqeKLLGQLKEVQADKEQSEaelqvaqq 291
gi 542210213  226 LAQEKIALMDAREASEARIRELEDDIKSLAQRAVEKETELERIKERAR-------RAGALRKDEESERRSLQtkleqtes 298
gi 47228659   231 LAQEKSTLLEANEESRVRIRELEEDVRTLTQRTVDRETEMERMKERAK-------RAGAQRKEEESERSALQskleqtea 303
gi 551523523  226 LAQEKAALMEVKAAKEQLIRELEEDIKTLTQRAVERETELERMKDRAK-------RAIALRKEEETENKGLQnkldqtea 298
gi 637263541  211 VSKQKDTLSLQEAEHLARIRELEGDIQAMGEKMLLRETELDRVKDTVKsllreqeQIHNQLKEEYAEKEQYQvklqasve 290
gi 821489940  212 LKEERDVLSKQQGDHVARILELEDDIHAISEKVLEKEVELDRVKDTVKaltqeqeKLLGQLKEEQADKEQSQ-------- 283
gi 1040657740 226 MSAEFNALLAERAENQQRIKELEQDSATLTQQKQDIEAELERMKERVK-------KMTIQRRDEETERRDLQ-------- 290
gi 972964507  216 -----------------RLKE-----------------RLRRLTQQQE-------QAVRQKGEEEEERKALQgkllssee 254
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123887473  289 --------------------------------------------A----------------------------------- 289
gi 160016577  299 elhslsaefqslrsslaqrdthalqlrdtittlthklnsahrkeA----------------------------------- 343
gi 160017736  292 enhhlnldlkeakswqeeqsaqaqrlkdkvaqmkdtlgqaqqrvA----------------------------------- 336
gi 542210213  299 elkslskefqglrnslaqrdtsvlqlqntittltqklttahrkeA----------------------------------- 343
gi 47228659   304 elrslskefqglrnslaqrdtsvlqlqstittltqkltaahrkeA----------------------------------- 348
gi 551523523  299 elrslskefqvlrnslaqrdtsvlqlqntittltqklttahrkeT----------------------------------- 343
gi 637263541  291 esrslasdlqeaknlhgekisqtlvlqedvnklqqklatanrrtA----------------------------------- 335
gi 821489940  284 --------------------------------------------Adlqasqveccrlstdlqkakshqdqqaselqrlqe 319
gi 1040657740 291 --------------------------------------------L----------------------------------- 291
gi 972964507  255 elrrmcsefqslrgslaeretqaltlrdtistltlrlntaqqreV----------------------------------- 299
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123887473  290 -----------------EHEATLKEMRSLQERLNTSERASEGLKSDLSSMVAQRDRTQSELHQARLQAAQLTLQLADASL 352
gi 160016577  344 -----------------ANELALNELRSVQERLNVSEHCVETLRGELRDMVAQRDSAHAELHQARLQAAQLTLQLADASL 406
gi 160017736  337 -----------------ELEPLKEQLRGAQELAASSQQKATLLGEELASAAAARDRTIAELHRSRLEVAEVNGRLAELGL 399
gi 542210213  344 -----------------ENEASLKEMRSLRERLHMSERAAEGLKSDLSSMVTQRDQGQAELHQARLQAAQLTLQLADSSL 406
gi 47228659   349 -----------------EHEATLKEMRSLRERLNTSERTSEGLKSNLSSMVTQRDRTQSELHQARLQAAQLTLQLADASL 411
gi 551523523  344 -----------------ESEASLKEMRSLRERFHISERTVEGLKSDLSSLAAQKDHVQAELHQARVQAAQLTIQLADASM 406
gi 637263541  336 -----------------QMEALCEQLRSTQDVLAASQQKVALLGEELASVASIRDRTISDLHKSRLEAAETNIKLADMTL 398
gi 821489940  320 evtrtqnlldeaqqhiaELEPLKEQLRGSQELAVSSQQKAALLGEELASTASARDRTMAELHRSRLELAEANNRLMELSL 399
gi 1040657740 292 -----------------ENEQMHADLRTLQERLEASERSTEALRRDLSELGSLQSHSHAELHQVRLQSAQMSLQLSQANL 354
gi 972964507  300 -----------------ENESLRQELSSLRERLCASERRVEGLGAELEVVGGQRDRGQTELHQARLEAAQLTLQLAETRL 362
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123887473  353 ALREGRARWAQERQGLQLTAEKDHARLQKLTAEMETIEESLQEERMERVKLEVEIGREKDCNRvqlcetrrelqELKTSV 432
gi 160016577  407 ALREGRANWAQERETLQQNAEIDKVRLERQNDEIQQKEEMLQKARMEREKAVVELGREKDCNR-----------ELKASL 475
gi 160017736  400 HLKEEKCQWSKERAGLLQSVEAEKDKILKLSAEILRLEKAVQEERTQNQVFKTELAREKDSSLvqlseskreltELRSAL 479
gi 542210213  407 ALREGRAHWAQERQNMQRSAEKDHERLEKLSQEMQAMEEMLQEERMERVKLEVELGREKDCNRvqlsetrrelqELKASL 486
gi 47228659   412 ALREGRARWAQERQSLQLSAEKDHERLQTLNAEIQKMEETLQEERMEKVKLEVEIGREKDCNRvqlcetrrelqELKASL 491
gi 551523523  407 ALREGRANWAQDRQSLQNAAELDQEHSERLNAELQKMQERLQEETMERVKLEVELGREKDCNRvqlserrrelqELKASQ 486
gi 637263541  399 KWKEGKGQWWKEKTTLLQNMEAEKDKILKLSAEVLRLEKSLQEERSQRQVLRVELAQERDSSLvqvsesrrelrELRAAL 478
gi 821489940  400 QWREDKGSWSKERTGLLQNVEAEKDKILKLSAEVLRLEKAVQEERTQRQGLKADLAQEKDSSLvqlseskreltELRSAL 479
gi 1040657740 355 ALREGQSTWAQERETLRQSAELDKDRVQKLSRELQKKEEWLQEERSEREKLEVELGIEKDCNR-----------EQRASL 423
gi 972964507  363 AMREGRARWQGEREALQQSAQMDRERIAELSEALQQAEARLQEERMEREKAEVELARDRDCNRvqrgeasrelqELKSSL 442
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123887473  433 RVTQKEKEQLLAEKQ------------------ELMHYICQLEQKTGTVSSAKWSAAPVLFPGR---------------P 479
gi 160016577  476 RVAQKEKEQLQTEIQ------------------EVMEYSRQLERRLEVLSDCKWSETALLQSSR---------------A 522
gi 160017736  480 RVLQKEKEQLQEEKQ------------------ELLEYMRKLEARLEKVADEKWNEDATTEDEeaavg------------ 529
gi 542210213  487 RVAQKEKEQLLAEKQ------------------ELMEYICQLEQKMGTVASAKWSLAPVASTGR---------------P 533
gi 47228659   492 RVTQKEKEQLLAEKQvrraaclhqspvltkedrELMQYICQLEQKTGMVSSAKWSTAPLLFPGR---------------P 556
gi 551523523  487 KVAQKEKEQLRAEKR------------------ELMEYICQLEQKTGTVTTARWDAAPIASTGR---------------P 533
gi 637263541  479 QVAQKEKEQLQAEKQ------------------ELLIYIRRLEERLEKVADDKWSESVLVDKEEtaleapasemfirdaL 540
gi 821489940  480 RVFQKEKEQLQEEKQ------------------ELLEYMRKLEARLEKVADEKWSEDAATEDEE---------------A 526
gi 1040657740 424 RALQKEQEQHQLEKQ------------------ELLDHIHVLELRLDTETDAKWAEAAATPISY---------------I 470
gi 972964507  443 RLGQREKEHLLHQQQ------------------ELLQYVRQLEQRLEAVADAKWRDAASDSNSR---------------P 489
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123887473  480 -----ASA-TSDSEDENPEALQplrPPRPLGNYSLCEQG--ELELLRLATPPPSPREAerSAVVINQPAPLT-----S-- 544
gi 160016577  523 -----ESPlLSDSEDENPEALQdthSSGPLNHYSLCEQP--QSDLLLPATPPPSPRHP--STVVISQPAPLS-----S-- 586
gi 160017736  530 --lscpAA-LTDSEDESPEDMR---LPP----YGLCERG-------DPGSSPAGPREAs-PLVVISQPAPIS-----Phl 586
gi 542210213  534 -----DSV-LSDSEDENPEALQilhPPRPLAHYSLCEQG--QPDSLLLATPPLSPREVsrREVVINQPAPLS-----L-- 598
gi 47228659   557 -----SSA-TSDSEDENPEALQplrPPRPLGNYTLGEQG--GPGSLDLTTPPPSPREAerSTVVINQPAPLS-----S-- 621
gi 551523523  534 -----ETA-LSDSEDESPEALQilhPPRSLGHYSLCEQG--QPDSLLLSTPAVAQRDTdrSAVVINQPAPLS-----L-- 598
gi 637263541  541 -----DSP-LSDSEDECPEDMR---LPAQIGSYSLCDNR-------AATTTPPCARGPa-RTVVISQPAPIAsqikqP-- 601
gi 821489940  527 tlgytTAV-LSDSEDEYPEDMR---LPA----HGLCERG--GP-----GCNPSGPRDTp-AHVVISQPSPIA-----Pht 585
gi 1040657740 471 -----DS---LSSIDEKPLLES---SSELSLSALDSEQ--------HNESTENNPKDNe-DD-VMQEDLEVQ-----Pfs 524
gi 972964507  490 -----DSP-VSESEEDSPEALQ---PPHPLGAYSLCDPPtfTTEALLLATPPPSPQ----GGVVISQPAPLS-----S-- 549
                         730
                  ....*....|
gi 123887473  545 ---PHQASAE 551
gi 160016577  587 ---PHQPSAR 593
gi 160017736  587 sgpAEDSSSD 596
gi 542210213  599 ---PHQATTD 605
gi 47228659   622 ---PRQASAD 628
gi 551523523  599 ---PHQANAD 605
gi 637263541  602 ---PEDSSSD 608
gi 821489940  586 trlHDDSSSD 595
gi 1040657740 525 sgiADQMLSE 534
gi 972964507  550 ---PRQQdse 556
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap