Conserved Protein Domain Family
DUF1664

?
pfam07889: DUF1664 
Protein of unknown function (DUF1664)
The members of this family are hypothetical plant proteins of unknown function. The region featured in this family is approximately 100 amino acids long.
Statistics
?
PSSM-Id: 336852
View PSSM: pfam07889
Aligned: 40 rows
Threshold Bit Score: 108.056
Threshold Setting Gi: 302851839
Created: 29-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75168971     93 LQA--LAVPAAALGALGYGYMWWKGLSFTDLMYVTKANMAAAVANLTKNLEQVSETLAAAKRHLTQRIQNLDDKVEKQID 170
gi 75275658     93 GAY--GITAVV-AGAIGYLYIRWKGWKLSDLMFVTKRGLSDACDVVGKQLEHVSENVNAAKRHLAGRIDHVDCTLDECQE 169
gi 548851628    30 sgagtYAMPILVIGVAGYGYIWWKGWKLSDMMFVTRRGFSDACSTVGKQLDRVSFSIKKTKEDLSSDINRVDGNLNDCAR 109
gi 721641523    90 GAL--TITAVVAAGVIGYAYIRWKGWKVSDFMWVTKRGLSDACNVVGNQLTEVSDSVHVAKKHLSGRIDRVDASLDEAQE 167
gi 552810301    84 GSYilYGSAAAGLGVVLYFRVL-RGWTFGDMLYATRRGLRDGLNQVSAGLEQLGAKVQEVKARLQERIAHVVRKQEEMLA 162
gi 302851839    94 WSV--YILPAAVVGGVVYLYVRIRGVSISDFFMVTNKSLQSFRELVSQSMTQLWEELRKQKDEFIKRIATVGEQQQAMMA 171
gi 1002266936   92 GTF--TITAVVVAGAVGYAYIKWKGWKLSDLMFVTKRGLSDACNVVGSQLDKVSDDVTSARKHLAGRIDRVDISLDETQE 169
gi 670431986    95 GPY--AITAVVVAGAIGYAYIKWKGWNLSDMMFVTRRGLSEACSAVGSHLDKVSDSVVVTRKHLAGRIARVDISLDETQQ 172
gi 1149761216   92 GAY--GLTFIA-VGAIGYLYIRWKGWKISDMMFVTKRGLADACNVVGKQLDQVSESVHASKKHLAGRIDRVDCSLDECHE 168
gi 293336363    93 GAY--GITAVVIGGAIGYLFIRWKGWKLSDMMFVTKRGLSDACNVVGKQVDQVSESVNVAKKHLAGRIDRVDCSLDECQE 170
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....
gi 75168971    171 LSKEINSQVISARENISSLEMDLESLHNLITGLDGKLDTLEYKQ 214
gi 75275658    170 ITESTRKEVTVIHEDISAFQEEMQSVHLVVRTLETKLGRLSYTQ 213
gi 548851628   110 ITAATEEKVVLLRDDLKLVGVDVQSVHRAVRSLEIKIGRIEQKQ 153
gi 721641523   168 IIEGTRDEVAIIHEDLSTFQRELQEVNHTVQIWGSRLSSIEDTQ 211
gi 552810301   163 VQAEMQAALTGVGRDVEHTRGQVGQIHAVVMDLEASMAEVGVNQ 206
gi 302851839   172 QQTQMDEKLLTVSEKVEEIRGISDSIDTRVCQMDNSIKHMStgv 215
gi 1002266936  170 IIEGTRDEVTVIHGDLSAFQEDLQSVNLVVRSLESKLVSLEYTQ 213
gi 670431986   173 IIEGTRDEVGIIHGDLSAFQEDLQSVNLVVRTLESKMGRLECSQ 216
gi 1149761216  169 IIEATGKEVTVIHGDLSAFQEEIQSVHHVVRTLETKLGRLAYTQ 212
gi 293336363   171 ITEATKEEVTIIHGDLSAFQKEMETVHLVVRSLETKLGRLAYTQ 214
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap