Conserved Protein Domain Family
DUF1667

?
pfam07892: DUF1667 
Protein of unknown function (DUF1667)
Hypothetical archaeal and bacterial proteins make up this family. A few proteins are annotated as being potential metal-binding proteins, and in fact the members of this family have four highly conserved cysteine residues, but no further literature evidence was found in this regard.
Statistics
?
PSSM-Id: 336854
View PSSM: pfam07892
Aligned: 186 rows
Threshold Bit Score: 70.8885
Threshold Setting Gi: 1141150966
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75541703   37 GINYAKKECTNPKRIVTSSVYIEDGEIDILPVKTKEDIPKSKINECMKSLKGLVVKAPVKIGDVIAENICDTGVDIVATR 116
gi 503153520  34 GEIYAKEELTAPKRIITSTIKVKGGIHKVVPVKTDGGIPKELNFECMKIISELEVEAPVKMGDIVVENILGSGVNLVITR 113
gi 524333747  37 GDAYARTECTHPVRSLATTVKVSGGIHNVVPCKSKGALPKEKIMDCMKAIADVEVKAPVKLGDILIENICDTGINIVATn 116
gi 524390887  37 GDAYARTECTHPERSLTTTVKVSGGVHPVVPVKSAKAVPKDKVKDCVKEIAKLEIKAPVKIGDVVCANILGTGVDIVATn 116
gi 524632341 372 GEAYARSEMTAPVRTITSFIRIEGSENKVVPVKTKEGIPKEKIWQCMKEIKQARVKAPVNVGDILIENAAGSGVPVVATg 451
gi 503169957  38 GKTYAEEEIVAPTRILPTTVKVKNGALPLCPVKTTKQIPLEIIHDAMAIIGQKEVEAPIEIGQIIIENILDSGADIVATR 117
gi 503153515  34 GEKYGFVELTAPTRVITSTIKITDGLHNRVPVKTDGAIPKELNVKCMELINSISAKGPVKMGDVIAEDIFGTGVNLVITR 113
gi 504121660  37 GLKYAETEFTEPKRTITTTVKLKSGLLPFVPVKTRDPVNKEKMFEVMNVIRKLEIESPVKVGDIVVSNIAGTGVDLVCTR 116
gi 524347048 382 GEAYAIKEVTSPERTLTTIMASDCKK--MIPVKTDRPVPKEKIEELMKIINEKTLLLPISLGDIIIENIGGTGANVVCTR 459
gi 524717013  38 GKAYAESEVVCPVRVLTSSVRATDGT--MVCVKTDKPIKKSEIFDIMKRINRATCTLPIKIGDVIVENIAD-GVNLVATg 114
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap