Conserved Protein Domain Family
DUF1673

?
pfam07895: DUF1673 
Protein of unknown function (DUF1673)
This family contains hypothetical proteins of unknown function expressed by two archaeal species.
Statistics
?
PSSM-Id: 311722
View PSSM: pfam07895
Aligned: 11 rows
Threshold Bit Score: 120.307
Threshold Setting Gi: 74527322
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74527351    3 MTLEYIKKLMGWCPNAKAFETRRSVCPEYLEADNQSRGKDAGnSPVPSPGWWNKRHNRSLI--DSSVFTLFSIYLIGFQG 80
gi 74527335    6 FVFDQIKKLMGWCPNARAHEARQHSNLENFASELPDRASGEN-EGLKNPGWLRKTNTYTLL--INTFLSLAYFLVINQLG 82
gi 74527332    6 VAFENIKKLIGWCPNARSHETQHSLHPEYFDANIPTRGGDTG--NSENLSWFRKSSSKILL--VDSFLTLTYLLVMTQLG 81
gi 74527338    3 LNTEYIKKLIGWCPNVRASEARRNVSFENFNSDIHERAGKEN-RDPKNLGWFRKASTRPLL--IYTFFTLIYLMVFHQIG 79
gi 74527353    3 VFIKSIRKLMGWCPNAKALETRHSICPEYLEADNQSRGKDAGnNPILPSGWWNKRHNRSLI--ASSVFTIFSLYWITFQG 80
gi 121686971   4 NIAETIRKVMGWCPNLGAMEARKAMQFDNLVVNAPDKSREPN---HKTMTWRNKYRNLILI--GSIFGTIGPINMFISWG 78
gi 74527322    7 AFIESIRKMMGWCPMKNSLGKRKQ-------ENNYPDFKFENgIVELGSSPADLQGNRIFKvhVNLFPEWWAVII----- 74
gi 74527324    2 AFIESIRKMMGWCPMKNSLGKGWQ-------EGNYPFFKMENgSIQLDPSPVDLRRNKILKvrYSLFDRWTVII------ 68
gi 74527344    6 LVCDQIKKFMGWCPNAKKLETGPRISSADFEA--YGRSGEEKaRSPEVLGSHSRLYTQLLL--LPMFFTPIYINIF-QKG 80
gi 125861662   2 KFSETIRRWMGWCPNAAMVSTSRR-----------QYAAPDGeVGMAREGNRDVVEGALVD--YGPIGTPGKLFILP--- 65
gi 503093184   4 rISETIHKWMGWCPAKTAMKSSMGISGYGIRKG-------------ETPGSPDRISSDRIVdyVPTWTSLLQFLVFG--- 67
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74527351   81 VspvderFMSGVILGII-----------FNLSLCIRTWS----YLDdiknSSRQRKIITVSSKEKIIkliniiialvily 145
gi 74527335   83 InltlsaNLILLLSGFF-----------IALFFVIFDWKkqmqRYD----ALVKHPVIDYSDKKLYY------------- 134
gi 74527332   82 V------NIVTLLAGFF-----------LSLTFFIFSWKkqmqRYD----TLAQKLVLDDSNKKILYk------------ 128
gi 74527338   80 I------SPIFLLAGSF-----------SSLFLSIFFWKkqmqKYD----ELIKKPVTECSNKRKMSlf----------- 127
gi 74527353   81 EslkneaFILGLIIGII-----------LNPLLCIWNWR----FLDkiknSNKK-----VRTKNKLM------------- 127
gi 121686971  79 Gk-----NMGIVLAGTF-----------LGILISKITWKttwhSLDriaiRIPRKAATKLSIKRIVVfg----------- 131
gi 74527322   75 -------ILFALIISLLlwtyspessflIILSEIILYLpl-ivLLLfhhpSTVTVMPEKIIVKRLIRkpvviekkdiiqi 146
gi 74527324   69 -------AIFTLIISLLlwiyipedsflIIFSGLIMFLIplilFLNr--pNIAEVTSGKIIIKKPMRkplviekedvmqi 139
gi 74527344   81 I------NLEAFLLGLS-----------LSLLTYLLGWKkqmhQYD----AAKEKPVISPFFRKIFFyvf---------- 129
gi 125861662  66 -------VAAALLIGCLfvma---pavgLFVLVIILAYSgm-eIYGvmrrARVEVTPDTITITRPLFrpivipkdavvkv 134
gi 503093184  68 -------TEIAAIVAFLkfvnkyypgtdILLLLCIMLVTgyliIYSdikrTTIESGPDVITVKRPGFrtvhiqksdinna 140
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74527351  146 ll----fsqfnwgfvlflisAFCLIALLYYFKFDFSPMVFLFYlgspntVFSSGIAG-ICLTAFLYYLTDVYWEKRNGKI 220
gi 74527335  135 --------------------ILAAVLFILIYNYYIEKQGLDLQ------AVFSFVGG-LVVGIWPFYFQLIYWEKKNHKT 187
gi 74527332  129 -------------------rLFRIITLIFYATLFYWIFAGDLErnflmkGTLSFFAG-GLAFMWLGYLQILYWEKKNHKT 188
gi 74527338  128 ------------------atIFAVYFVMSYIMSYLDANAGELAv----qAMISFIGG-FLVSMWLEYLQILYWERKNRKV 184
gi 74527353  128 --------------------TIAGILGLTTLLIESSSRGGEFVl-----TFSLTCASgFCLTAFLYYLTDTYWEKKNKKI 182
gi 121686971 132 ------------------iiIFIYVAVITHFMSIYGLR-----------SVVAFLGGcGMSLLWSHYMQIVQWERKNQKT 182
gi 74527322  147 svtrnenrslrwpmrlvflvTLPII-----LLRTVERIVRDLQlea-aaSASAKLSLfLSQSLTVTYLLVFFYYFE---- 216
gi 74527324  140 svtrtenhylrwlvrsiyvvFIPLY--------FVKEIMPTLQemersfPEYIDLSLfLLNLTVLVMFLVMFYNFE---- 207
gi 74527344  130 ------------------lfPFLSLGLLIAFLPYISSHAAYLFnd---qVLYSFFSG-TMILMWGFYFQLIYWERKNHVK 187
gi 125861662 135 evkenklpipywllmgalamIFLSA-------------AGGIYyglsnpTSMRFISGlGA----AIFFPVIFYRTY---- 193
gi 503093184 141 eiidnhrpvpqfvlailgliIIPVFSVVSIYGRYVEWISGEI-------LTPLFIAYlGFFIVISIFFLVIYNYAR---- 209
                        250
                 ....*....|....*....
gi 74527351  221 VlVYDRKM--SEICIVNAE 237
gi 74527335  188 IyFDKSYGtwKNSYIIRER 206
gi 74527332  189 IyFDKGYGkwKNSYIIRER 207
gi 74527338  185 IyIDKGYGw-KKSYIILER 202
gi 74527353  183 VlLEGYYA--PEIYVINKD 199
gi 121686971 183 L-VKSGYA--TPIVVVSND 198
gi 74527322  217 --IRAPYQ---QILKMTTY 230
gi 74527324  208 --LMAPYQ---RILKVTTR 221
gi 74527344  188 MyMKREKGq-HKLYVLGEK 205
gi 125861662 194 --VRTHYP---QILTITTE 207
gi 503093184 210 --IRKRYP---KSFVITTK 223
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap