Conserved Protein Domain Family
Frigida

?
pfam07899: Frigida 
Frigida-like protein
This family is composed of plant proteins that are similar to FRIGIDA protein expressed by Arabidopsis thaliana. This protein is probably nuclear and is required for the regulation of flowering time in the late-flowering phenotype. It is known to increase RNA levels of flowering locus C. Allelic variation at the FRIGIDA locus is a major determinant of natural variation in flowering time.
Statistics
?
PSSM-Id: 311726
View PSSM: pfam07899
Aligned: 59 rows
Threshold Bit Score: 211.316
Threshold Setting Gi: 75218990
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75134798  105 AAEGVAESLRAMCARMDSAGFFGFVVARRKEVDALRAEMPPALKCCVDPAKFVMDAVADVFPV-DRREAKN--PTDLAWA 181
gi 356507404 103 EEEEEEDELLTLCKTMNSRGLRKYVLTRLSETASLREQVPLALRSAPNPSRLVFECIGRFFLQgSKAYTKDspMIPARQV 182
gi 971571524 201 SSPRSSSEVKILCETMNSHGLRKYMIRRLSCLKTLQQKVPKALKLSPNPARLILEAIGMFYTQgSNTYVEGspLITERRA 280
gi 970036214 225 ELKSPRSELEIFCETMDHCGLRKYMTTHISNFRRLREEVHKALRLSPNPATLVFNCIGKFYITaGKKFANEspLGRGRKA 304
gi 460380241 133 eLKSTRSELESICKRVDGRGLRKYMITHISDINVLLEEVPKALKLSRNPARLVLDCVGKFYLQgSRAYVKGspVVNGRKA 212
gi 460413855  45 DSKSPDSQLETLCKTMCGKGLRSYILSKLPEKNTLREELTKALKLAPNAAKLVLSCMGDFFAKrGKAFDKDarMIATREA 124
gi 923638854 119 SPPKEKSEAERFCESMWSKELRRYMFVNISERAKLIEEIPGALKLAKDPAKFVLDCIGKFYLQgRKAFAKDlpAITARKV 198
gi 915744614 140 pETSNKTEGERLCELMCSKGLRKYIYANISDRAKLMEEIPSALKLAKEPAKFVLECIGKFYLQgRRAFTKEspMVSARQV 219
gi 566207193 140 APATEKPEIRSLCQMMCGRGLRKYIVSNLASVEKLREEVPEALKCAPKPAKLVLDCIGRFYLQgSKAYEKEspMITGREA 219
gi 255539979 130 AKSSSSSELISLCEMMCGRGLRKYLTSNLTNIPKLRNEVPTALKYAPKPAKLVFDCFGGFYLQgSRAYTKDspMVPGRKA 209
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75134798  182 CVLILEAAVPALAdpdpeigAARLLVPRAARERARGMAREWKEAAERKGGVEWTKPPDAHAFLQHVATFAVAEREDRGIY 261
gi 356507404 183 SVLVLEYYLLSGCv------GNEVDLEASLKREVDSAAVAWRKRIFVEGGLLKAAEVDARGLILFIAIFGIPTVFKDEDI 256
gi 971571524 281 LVLLLECFLRMIGege--geGSSVEIENGEKEEAGQAALAWYRRLNFEGGILKAQEIDARGLLLFIGCFGIPQAFRNEDI 358
gi 970036214 305 KVLILECLLLMIGi-----yDKEIELENWVKEEAEHRALAWLERMNSEGG--KPQEIDARGLLFFIGGFGIPDQFTNANI 377
gi 460380241 213 SILVLDCFLLMGI-------DEGVEIEKEVKEEAEKAALAWRKRLIAEGGLRKVYDMDARGLLLLIGCFGIPGAFSNEDI 285
gi 460413855 125 SALVLECFLLIGF----------DVIDEGVKEEAAQAAVIWRRRFVDERGIRKASTMDARGLLLLIGCFGIPQIFYNEDI 194
gi 923638854 199 SLLILECYLLTFDpe---geKKKKLLVSSVKDEAEAAAVAWKKRLVGEGWLGAAEAMDARGLLLLVACFGIPESFKSMDL 275
gi 915744614 220 SLLILESFLLMPDr-----gKGKVKIESCIKDEAETAAVAWRKRLMSEGGLAAAEKMDARGLLLLVACFGVPSNFRSMDL 294
gi 566207193 220 SILVLEFFLLISD--------HENAMEAAVKKEAEQVALAWRKRLISEGGVRNSGEIDAKGLLLLIGGFGIPKLFSDEDV 291
gi 255539979 210 SILVLELFLLILD--------DGIQFDSDLRQEAQQAAAAWRKRLIAEGGVSKACEIDARGLLLFVGCFGIPKVFTSGDI 281
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75134798  262 RRIVVSFS-WRRQMPRLALTLGLEEDMADIIEELIAKGQQLDAVNFAYEAGLQEKFPPVPLLKSYLADSK-------KTS 333
gi 356507404 257 YSLVSASN-GREFSDALLKSQPLLKRVSDVADGMIKKGMAVKAVDLAYTFGFEEKYSPRTALTSFLQKSE-------ETW 328
gi 971571524 359 KDLLHQSY-IKMISSSVRRSSVLMAKIPEIIEGMLNQNMVVDAVYFTFCFGLEDRFNPQRLLTSFLHESEvslcnkiQTF 437
gi 970036214 378 RNLIQVSN-LKWSCDALKRSNALLAKLPEIIEEMVANKAVVKAVHIVYSVGMEDKFNPRTLLTTFIRESK-------KSF 449
gi 460380241 286 RDLFLASPfKKNISCSLTRSNVFMAKITEIIEGMVNQKMEMEAVDLAYTFGMEDRFNSQKLVTTYLRESK-------EPL 358
gi 460413855 195 RDLIRVSN-IREISTALRRSNVLMEKIPDIIAGMVKNKMEVDAVDVAYTFGVEEKCSPCEILSSFLEELR-------ESL 266
gi 923638854 276 LDLIRQSG-TDEIVGALKRSPFLVPMMSGIVDSSFKRGMHIEALELVYTFGMEDRFSPSSILTSFLRMRK-------DSF 347
gi 915744614 295 LDLIRMSG-SNEIAGALKRSPFLVPMISGIVESSIKRGMHIEALEMVYTFGMEDKFSASSVLTSFLRMSK-------ESF 366
gi 566207193 292 FDLVKLSN-SRQFADLVRRSRSLVTRVTDIIEGMMKKGMKIEAVDVACIFGIEDKFPAQNLLTLILQESR-------EPL 363
gi 255539979 282 WDLIRSSN-LQQISDALKRSHVLVTKVSDILERMMNNGMKIEAIDVAYTFGIEDKFPPQKLLTSFLRDSK-------EAL 353
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75134798  334 CTVsDNSSTS--SgQSGSNANKKEQSVLRAVIKCIEDRKLEAE--FPLEDLQRQLEELEKAKTEKKKATS 399
gi 356507404 329 KKAkQDARDFp---SALKVAHEKYLAALKSVVNCLEGHKIDFVklLPGWQLKNKITNLEKDIGDANKKIE 395
gi 971571524 438 EQNkGSKDSAl---QEIIGAKRRYLGTLKSVIQCLGRNNIDHSkfLSEWQIGEKVIGLEKEITQFRKNLK 504
gi 970036214 450 DNMnGSQSa---H-QGNIVAKGKYLGDLRSIIKCLRIHEVDPSkvLPGWEISKRIASLEKEISEFNKQil 515
gi 460380241 359 KKMkGKPQGSl---AAVHEAKKKHLAALRSVIKCSRRHNIDLSklLPGWKINEQIMCLEKEIEVGEKKMA 425
gi 460413855 267 KKKkCQSHGSh---aVVNEANKRELSTMKSVIECLEAHNIDPSklIPRFRISDRIMSLEEKIARNDQrre 333
gi 923638854 348 ERAkRQAQAP----MASKTANEKQLDALSSVMKCLEAHKLDPAkeVPGWQIKEQMAKLEKDIVQLDKQME 413
gi 915744614 367 ERTkRKAQSP----LAFKEAAAKQLAALSSVMRCMETHKLDPAkeLPGWQIKEQIVNLEKDTLQLDKEME 432
gi 566207193 364 KGRkRKANNSpaI-QLEKEAKEKQLIALKSVVKFLEEHQLDPTklLPGWQLEEKTTELEKDIADLNKKig 432
gi 255539979 354 KRRrREANNSp---VLLKEASQKHLSTLKSAMKFLEGRKLDPKklLPGWQVTEKIDKLEKEIADLNRKId 420
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap